Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My WebLink
About
07 Approval to Purchase Emergency Generator for the Ocoee Regional Law Enforcement Training Facility
City of Ocoee ▪ 1 N. Bluford Avenue ▪ Ocoee, Florida 34761 Phone: (407) 905-3100 ▪ www.ocoee.org STAFF REPORT Meeting Date: February 3, 2026 Item #: 7 Contact Name: Stephen Krug Department Director: Stephen Krug Contact Number: Ext. 6002 City Manager: Craig Shadrix Subject: Approval to Purchase Emergency Generator for the Ocoee Regional Law Enforcement Training Facility. (Public Works Director Krüg) Background Summary: On May 6th, 2025, the City Commission approved the contract with Fortress Secured, LLC (Fortress) to construct the Regional Law Enforcement Training Facility (RLETF). Following a review of the costs for providing the emergency generator, it was determined the City could save approximately $40,000.00 by purchasing the equipment through the City's Sourcewell cooperative purchasing membership. Public Works is requesting approval to purchase the generator from Zabatt Power Systems through their Sourcewell contract for $109,967.85. The RLETF contract with Fortress includes a $150,000.00 line item to furnish and install a generator which will be deducted from the contract through a change order in the near future. Public Works recommends approval to purchase the generator from Zabatt for the RLETF. Issue: Should the Honorable Mayor and City Commission approve the purchase of the emergency generator for the Regional Law Enforcement Training Facility through Zabatt Power Systems? Recommendations: Staff recommends the Honorable Mayor and City Commission approve the purchase of the emergency generator for the Regional Law Enforcement Training Facility through the Sourcewell contract with Zabatt Power Systems for $109,967.85 and authorize City Manager and staff to approve change orders to the purchase per the Purchasing Policy as funded in the project. Attachments: 1. RLETF Generator Zabatt Estimate - SO174975 rev 3 2. RLETF Approved Submittal 263213-1.1 2023-P010 Ocoee LE Generator SGM REV 01.15.2026 A Financial Impacts: There is adequate funding in the project under job# P000353 and a deductive change order will be issued to the contractor to less out the $150,000.00 from the contract. Type of Item: Consent Page 187 of 414 CBC1257077 EC13013144 Date: December 19, 2025 Salesman: Anthony Bonavire - ZPS Customer: City of Ocoee Project Name: City of Ocoee Proposed PD budget Estimate #: SO174975 Rev: 3 (Sourcewell Contract # 092222-GNR) *Estimate expires 15 days from issue date WE ARE PLEASED TO OFFER THE FOLLOWING ESTIMATE FOR YOUR PROJECT Quantity 1 - Generac Industrial generator, consisting of the following features and accessories: 38 - 40 WEEK ESTIMATED LEAD TIME* *Lead time: -Is estimated and subject to change -Does not include transit time SD175 Stationary Emergency-Standby rated 175kW Rating 120/208 VAC three phase, 60Hz Diesel PMG Level 1 Acoustic Enclosure, Steel DSE G8601 Digital Genset Controller 600 amp 100% rated LSI Electronic MLCB - w/ std factory lugs - w/ shunt trip & aux contacts 10 Amp Battery Charger Battery, battery rack & cables 705 gallon UL142 DW sub-base tank (approx. 52 hr runtime @ full load) - Emergency vent - FDEP compliant w/C Channel Coolant Heater Pad type isolators, loose 21 Light Annunciator – Surface Flush Mount Annunciator Kit Remote Emergency Stop Switch, break-glass, shipped loose Std set of 3 Manuals UL2200 EPA Certified Quantity 1 - Automatic Transfer Switch 18 - 20 WEEK ESTIMATED LEAD TIME* *Lead time: -Is estimated and subject to change Phone: 904-3844505 • Email: sales@zabatt.com • Website: http://www.zabatt.com Page: 1 / 5 Page 188 of 414 -Does not include transit time TX Series Rated at 600 Amp 208 Volt, 3 Phase, 3 Pole Service Entrance Rated Auxiliary contacts Signal before transfer Programmable exerciser Strip heater NEMA 3R Enclosure ONE LINK COMMERCIAL Remote monitoring system: - Email / text alerts for selected alarms - Cellular connectivity - Password protected Web Portal featuring real-time status and access to 1 week historical data - Remote start/stop capability - Includes parts, labor, programming, and training -1 Year warranty (from date of install) -1 Sim card (for cellular monitoring) -Includes 1 One year of cellular service (recurring fee thereafter) Note: Hardwired, Ethernet cable from customer network to equipment panel is not included MISCELLANEOUS NFPA 110 On-Site Start Up and Testing 2 Hour Resistive Load Bank Test (Performed Onsite) 1 Year Quarterly Maintenance Agreement, consists of (1) Major and (3) Minor visits per year FOB Origin, full freight allowed to first destination WARRANTY Generator: Comprehensive 5-Year Warranty (from date of performing start up) ATS: Standard 1 Year Warranty (from date of shipment from factory) THE FOLLOWING IS NOT INCLUDED Fuel Concrete Pad Electrical and Mechanical Installation Distribution panel and circuit breakers Not AHCA Compliant Phone: 904-3844505 • Email: sales@zabatt.com • Website: http://www.zabatt.com Page: 2 / 5 Page 189 of 414 PRICE $109,967.85 Plus Applicable Sales Tax Built in discount of 2.5% has been applied to estimate for payments that are remitted as cash, check, EFT or wire transfer. Due to the uncertainty of costs for our products, based on potential tariffs, this price is an estimate and subject to change. (see above) Estimated Lead Time* *Does not include transit time. Lead time is estimated and subject to change. Phone: 904-3844505 • Email: sales@zabatt.com • Website: http://www.zabatt.com Page: 3 / 5 Page 190 of 414 COMPLIANCE REVIEW Zabatt Power System’s estimate to provide the standby generator package meets or exceeds the intent of the specification sections provided with the exception of the following: No engineering specification provided Electrical One-Line Diagram not provided All dimensions are approximate for estimating purposes ONLY *****Request installation drawings***** Zabatt is an equipment supplier. It is the responsibility of the Specifying Engineer, Installing Contractor or End User to ensure that the equipment is selected and installed in accordance with Local and National codes. CHANGES, CANCELLATIONS & RETURNS Any order or contract may be cancelled by the customer only upon the payment of reasonable charges and expenses incurred by Zabatt on or before the date of receipt by Zabatt of said notice of cancellation. Such reasonable charges and expenses may include, but are not limited to, any cancellation charges incurred by Zabatt for the cancellation and/or any liabilities for orders or commitments for materials or services previously ordered by Zabatt in connection with the cancelled customer order or contract. No material or product may be cancelled or returned for credit without first obtaining the written approval of, and at the sole discretion of, Zabatt. All shipping costs on returned material must be pre-paid by the customer. Accepted returns are subject to the charges, terms and requirements notified in writing to the buyer (which may include, with no limitations or exceptions, a 15% restocking fee). DELIVERY, SHIPMENTS, & CLAIMS (to include Warranty) All charges for work performed during the warranty period are the responsibility of the customer until approved by the appropriate warranty authority. Warranties are subject to the manufacturer’s guidelines. Even those warranty claims which are approved may not include 100% of the repairs or parts; the customer is responsible for charges excluded from warranty. Contingency payment arrangements must be made prior to any warranty work being performed. Batteries, oil, coolant, filters and adjustments are not covered as part of warranty repairs and will be billed to the customer at appropriate rates. PRICE & MINIMUM BILLING Price shall be in accordance with rates currently in effect at the time the estimate is received and shall expire on the date described in said estimate. All estimates for services, parts, equipment, and labor will be issued in writing and have a system generated estimate number. Verbal estimates are not valid and should not be accepted. A signed copy of the estimate must be on file before any work can be performed. Signature on said estimate shall serve as the customer’s acceptance Zabatt’s billing guidelines and rates. Labor prices on estimates are good for a period of (15) fifteen days from the date of issue unless otherwise specified. Parts and equipment prices are subject to change and billed at the current price at the time of purchase unless otherwise specified. All regular service calls and emergency calls within normal hours will be billed for a minimum of one hour of labor and ten miles of travel. All emergency after-hour calls will be billed for a minimum of four hours labor and ten miles of travel. CREDIT & PAYMENT TERMS Commercial customers who have not established a credit account with Zabatt must make payment arrangements before goods are delivered or a technician is dispatched. No credit terms will be extended to end-users. We cannot accept payment on site but must have a signed credit card authorization on file in order to perform any service work Phone: 904-3844505 • Email: sales@zabatt.com • Website: http://www.zabatt.com Page: 4 / 5 Page 191 of 414 on new accounts. No work will be performed for, or product delivered to, customers who are on credit hold. This hold includes any emergency repairs and warranty work that may be required. Account must be paid in full or alternate means of payment must be coordinated and approved before work is performed or product is delivered. Service Rate Definitions and Conditions are available as a separate document. AGREEMENT This agreement consists of, and is limited to, a qualified technician performing scheduled maintenance in accordance with the manufacturer's recommendations. Zabatt, Inc will not be held liable for damages to the equipment or property as a result of equipment failure caused by any of, but not limited to, the following circumstances: improper or unauthorized operation; normal wear and tear or damage due to overloading; vandalism, theft or acts of a third party; acts of nature; failure to perform services due to hazardous conditions and other causes beyond the control of Zabatt Inc. Signature and acceptance of this estimate constitutes agreement to comply with Zabatt's terms and conditions as attached Customer: City of Ocoee Estimate: SO174975 / Date Issued: December 19, 2025 ____________________________________ Signature of Zabatt Representative Anthony Bonavire - ZPS tony.bonavire@zabatt.com ____________________________________ Date ____________________________________ City of Ocoee Authorized Signature ____________________________________ Printed Name ____________________________________ Date ____________________________________ PO Reference Number Phone: 904-3844505 • Email: sales@zabatt.com • Website: http://www.zabatt.com Page: 5 / 5 Page 192 of 414 TO: WE TRANSMIT: FOR YOUR: Herewith Use THE FOLLOWING: JL2 Architecture , Shop Drawings/RFI January 15, 2026 2023-378 Ocoee Law Enforcement Training Facility PROJ #: PROJECT: DATE: Jeremy CoxATTN: COPIES TO: Via:E-mail Delivery Pick Up Overnight Second Day FAX FAX:( ) - 0 Corrections or comments made on equipment submittals or shop drawings during this review do not relieve contractor from compliance with requirements of the drawings and specifications. This check is only for review of general conformance with the design concept of the project and general compliance with the information given in the contract documents. The contractor is responsible for: confirming and correlating all quantities and dimensions: selecting fabrication processes and techniques of construction; coordinating his work with that of all other trades and performing his work in a safe and satisfactory manner. Letter of Transmittal Orlando, Florida Tampa, Florida 935 Lake Baldwin Lane Orlando, FL 32814 Tel: 407-767-5188 Fax: 407-767-5772 sgmeng@sgmengineering.com Miami, Florida Submittal Item ActionCopies Reviewed By Engine Generators Reviewed1 Mark E II PREPARED BY:Kelsey Kappas Administrative Assistant Page 1 of 193337Transmittal No.: 935 Lake Baldwin Lane. Orlando, FL 32814 • Ph. (407) 767-5188 • Fax (407) 767-5772 Page 193 of 414 #263213-1.1 Generator 263213 Summit Construction Management Group x Resubmittal for #263213-1.0 no exception taken Summit Construction Group 12/23/2025 Generac /Generator 01-13-26 Thomas E Shaw Digitally signed by Thomas E Shaw Page 194 of 414 Division of Zabatt, Incorporated 4612 Highway Avenue Jacksonville, FL 32254 PH: 904 384 4505 FX: 904 394 7446 www.zabatt.comJacksonville Orlando Tampa SUBMITTAL REVIEW Approved Approved as noted (Comments page 2) Revise - Resubmit City of Ocoee PD S175, 175kW Generator Set Salesperson: Prepared By: Tony Bonavire Brandon Paul 12/22/2025 Page 195 of 414 SUBMITTAL REVIEW COMMENTS Page 196 of 414 Power Systems SCOPE AND DIVISION OF RESPONSIBILITIES 1) CONTRACTOR’S RESPONSIBILITIES a) EQUIPMENT DELIVERY (1) Equipment will be delivered at one time. Additional deliveries for items such as transfer switches, louvers, battery chargers, remote annunciators etc. may be subject to additional charges. (2) Zabatt Power Systems will provide delivery to the jobsite ONLY. Offloading, including cranes or forklifts, rigging and spreader bars are solely the contractor’s responsibility. Refer to the Installation Reference Guide for proper offloading procedures. (3) All quoted charges for deliveries shall be made on weekdays during normal business hours (8:00am-5:00pm). Special delivery arrangements can be made, but may be subject to additional charges and availability. (4) It is common for items to ship loose with generator sets. It is the contractor’s responsibility to identify these items and store them for later use. Lost items needing replacement will be charged back to the customer. b) PROJECT INSTALLATION i) FOUNDATION DESIGN (1) Equipment shall be set on a foundation designed and constructed according to load requirements and soil conditions. Foundation should also meet any manufacturer recommendations and must meet any local regulations. (2) The length and width of the concrete base should exceed the length and width of the engine-generator by a minimum of at least 12 inches (0.305 meters) on all sides. Refer to Pad Drawing or the Installation Reference Guide included in the submittal. (3) The floor or structure on which the generator is set must be able to support 125% of the engine-generator weight and, if applicable, weight of the fuel tank. (4) If engine-generator is to be operated in parallel with other units, it is possible that out-of-phase paralleling might occur. Out-of-phase paralleling can cause abrupt torque reactions and demands a stronger foundation. When units are operated in parallel, their foundation must be designed to hold twice the unit’s wet weight. ii) WIRING TERMINATION (1) Must be done in accordance with any codes, rules and regulations that apply. Offices Jacksonville Orlando Tampa HEADQUARTERS 4612 Highway Ave Jacksonville, FL 32254 PH: 904-384-4505 FX: 904-384-6478 www.zabatt.com Page 197 of 414 (2) Supply and terminate all inter-connecting (DC) control wiring between generator set, automatic transfer switch, battery charger, remote annunciate, fuel tank, etc. (3) Control wiring shall be sized accurately to avoid voltage drop. Control wiring shall be stranded conductor type. (4) Supply and terminate load cables. Lugs are not provided unless specifically called out in Zabatt’s Bill of Material. (5) Supply and terminate AC power to AC powered accessories. Power must be available, but this equipment should not be energized prior to Zabatt technicians’ arrival. (6) Control wiring must be run in separate conduit from power wiring to avoid induced voltages. iii) FUEL SYSTEM (DIESEL) (1) Supply an adequate amount of high quality fuel for Start-Up and load bank testing. Generac recommends low sulfur #2 diesel fuel. (2) When fueling unit, sufficient space should be left in tank to allow for expansion of fuel. Tank should be observed immediately after fueling and for the next 24 hours. Florida Department of Environmental Protection (FDEP) requires fuel tanks over 550 gallons to be registered with the State. It is the end-user responsibility to ensure the fuel tank is registered with the State. iv) FUEL SYSTEM (LP and NATURAL GAS) (1) Local fuel/gas codes usually dictate the maximum pressure at which (natural gas)can enter a structure. In order to reduce the gas pressure on (LP and Natural Gas) a primary regulator (supplied by the installing contractor) is required. (2) Follow the local codes on selecting the required AGA approved, and UL listed, for Natural Gas application flexible portion of the fuel line (supplied by the installing contractor). (3) LP and Natural Gas pressure should be set at 5-14 inches water column for units less than 70kW or, 11-14 inches of water column for units 70kW and larger. c) START-UP PROCEDURE i) No start-up will be scheduled until a signed and completed Zabatt Start-Up Request from is received. The Start-Up Request is a checklist of pre-start-up requirements. ii) Please read your start-up request and ensure that all items are acknowledged, mark N/A where applicable, before returning to our office for scheduling. iii) Start-Up may require up to a week for scheduling, after receipt of the completed Start-Up request. The site contact provided will be contacted within that week of the scheduled start-up. iv) Contractor or contractor’s representative must be present during Start-Up. Any deficiencies found during start-up must be corrected prior to the Zabatt technician completing the start-up. v) Any deficiencies which cannot be corrected before completion of the start-up may require a return trip. Wait time and return trips are subject to additional charges. yg Florida Department of Environmental Protection (FDEP) requires fuelp( tanks over 550 gallons to be registered with the State. )q It is the end-user gg responsibility to ensure the fuel tank is registered with the State. Page 198 of 414 vi) Start-Up procedures shall be limited to those specified or included in Start-Up Guidelines. Exception is taken to any specifications that are unsafe/contradict or are in conflict with procedures and project scope. vii) Additional visits or delays of standard Start-Up activities due to incomplete site preparation will result in additional charges. viii)Start-Up shall be performed on weekdays during regular business hours (8:00am- 5:00pm). Special Start-Up arrangements are available with advanced notice and at additional charges. Page 199 of 414 2) ZABATT POWER SYSTEMS RESPONSIBILITIES a) EQUIPMENT DELIVERY i) Provide delivery to jobsite – offloading by others. b) INSTALLATION i) Provide project information and submittal drawings as required. ii) Provide product support for materials supplied by Zabatt as part of their scope of work. iii) Provide Operation and Maintenance Manual(s) upon completion of testing. c) START-UP i) Process customer’s Start-Up Request in a timely fashion for prompt scheduling of start-up. ii) Perform Start-Up Inspection in compliance with specifications and manufacturers requirements. iii) Advise and keep the customer informed of any deficiencies found during start-up. iv) Inspect all interconnecting control wiring for accuracy and correct termination. v) Inspect load cable termination and verify correct phase rotation. vi) Inspect AC power terminations for accuracy and authorize the contractor to energize the AC powered components. vii) Inspect fuel system installation. viii)Inspect exhaust system installation. ix) Perform Start-Up procedures which shall be limited to those specified or included in Start-Up Procedures. Exception is taken to any specifications that are unsafe/contradict or are in conflict with procedures and project scope. x) Check all control functions, safety shutdowns and verify system performance. xi) Perform load test if called out in Bill of Materials or Salesperson’s Quote. xii) Conduct training session with owner’s representative. It is the site contact’s and/or contractor’s responsibility to ensure that all persons (including end user) are present on the day scheduled for start-up/training/testing. Page 200 of 414 PROJECT SUMMARY 1 Page 201 of 414 'HFHPEHU $QWKRQ\%RQDYLUH=36 &LW\RI2FRHH &LW\RI2FRHH3URSRVHG3'EXGJHW 62 5HY 6RXUFHZHOO&RQWUDFW *15 :($5(3/($6('722))(57+()2//2:,1*(67,0$7()25<285352-(&7 !" #$ % & %' (') %' $ *! +,-#./- 0/ -#.1 10 $ !# $ $2 ( % ! $ 6' 6WDWLRQDU\(PHUJHQF\6WDQGE\UDWHG N:5DWLQJ 9$&WKUHHSKDVH+] 'LHVHO 30* /HYHO$FRXVWLF(QFORVXUH6WHHO '6(*'LJLWDO*HQVHW&RQWUROOHU DPSUDWHG/6,(OHFWURQLF0/&% ZVWGIDFWRU\OXJV ZVKXQWWULS DX[FRQWDFWV $PS%DWWHU\&KDUJHU %DWWHU\EDWWHU\UDFN FDEOHV JDOORQ8/':VXEEDVHWDQN DSSUR[KUUXQWLPH#IXOOORDG (PHUJHQF\YHQW )'(3FRPSOLDQWZ&&KDQQHO &RRODQW+HDWHU 3DGW\SHLVRODWRUVORRVH /LJKW$QQXQFLDWRU±6XUIDFH )OXVK0RXQW$QQXQFLDWRU.LW 5HPRWH(PHUJHQF\6WRS6ZLWFKEUHDNJODVVVKLSSHGORRVH 6WGVHWRI0DQXDOV 8/ (3$&HUWLILHG !/ - ') ( *!+,-#./- 0/ -#.1 10 $ !# $ $2 ( % 3KRQH (PDLO VDOHV#]DEDWWFRP :HEVLWH KWWS ZZZ]DEDWWFRP 3DJH Page 202 of 414 ! $ 7;6HULHV 5DWHGDW$PS 9ROW3KDVH3ROH 6HUYLFH(QWUDQFH5DWHG $X[LOLDU\FRQWDFWV 6LJQDOEHIRUHWUDQVIHU 3URJUDPPDEOHH[HUFLVHU 6WULSKHDWHU 1(0$5(QFORVXUH 3 0# ,3..4#/0 5HPRWHPRQLWRULQJV\VWHP (PDLOWH[WDOHUWVIRUVHOHFWHGDODUPV &HOOXODUFRQQHFWLYLW\ 3DVVZRUGSURWHFWHG:HE3RUWDOIHDWXULQJUHDOWLPHVWDWXVDQGDFFHVVWRZHHNKLVWRULFDO GDWD 5HPRWHVWDUWVWRSFDSDELOLW\ ,QFOXGHVSDUWVODERUSURJUDPPLQJDQGWUDLQLQJ <HDUZDUUDQW\ IURPGDWHRILQVWDOO 6LPFDUG IRUFHOOXODUPRQLWRULQJ ,QFOXGHV2QH\HDURIFHOOXODUVHUYLFH UHFXUULQJIHHWKHUHDIWHU 1RWH +DUGZLUHG(WKHUQHWFDEOHIURPFXVWRPHUQHWZRUNWRHTXLSPHQW SDQHOLVQRWLQFOXGHG .#00/ 35 1)3$2Q6LWH6WDUW8SDQG7HVWLQJ +RXU5HVLVWLYH/RDG%DQN7HVW 3HUIRUPHG2QVLWH <HDU4XDUWHUO\0DLQWHQDQFH$JUHHPHQWFRQVLVWVRI 0DMRUDQG 0LQRUYLVLWVSHU\HDU )2%2ULJLQIXOOIUHLJKWDOORZHGWRILUVWGHVWLQDWLRQ +/44/ -6 *HQHUDWRU &RPSUHKHQVLYH<HDU:DUUDQW\ IURPGDWHRISHUIRUPLQJVWDUWXS $76 6WDQGDUG<HDU:DUUDQW\ IURPGDWHRIVKLSPHQWIURPIDFWRU\ -783003+# "# 3-# 05 )XHO &RQFUHWH3DG (OHFWULFDODQG0HFKDQLFDO,QVWDOODWLRQ 'LVWULEXWLRQSDQHODQGFLUFXLWEUHDNHUV 1RW$+&$&RPSOLDQW 3KRQH (PDLO VDOHV#]DEDWWFRP :HEVLWH KWWS ZZZ]DEDWWFRP 3DJH Page 203 of 414 ! ! !" !#$ %& %' (# TM (&# )* ® & + ,"# *-. " *+% $ *+/ %& /0 %& ( *& % '# (% %(% (% &%+ 1 &%+ 1 %%1+& %1 2 3 - 4 0 5 6 4 4 4 5 ' 0 5 4 7 8 5 5 5 5 8 5 5 5 9' 0 5 9 4 5 9 6 8 9 5 5 4 5 ' 0 5 56 8 6 8 9 ' 56 6 64 8 4 64 1 5 4 5 ' 0 5 5 5 : 45 5 6 56' !" # ! $#!" %& +. % & + 5 Page 204 of 414 ' ( ) *+ ,- ; < ) += ; % ; - 0 ; & & -=8 +=6 % 5 ; -5 - < % ; > )5 2< & < 3 ; + % ; % 5 & 5 ()$ ,- ; - !5 & ; . - - ..$+* ,- ; % % >54 & ; ?< > ; -5 1 > ; ? + 6 0 5 ; > ) += $+ $ ,- ; ( %6 ; ( %8 ; ( @ ; >881( + +5 5 % 5 ; & 5 4 & / $.) /+ 0 ; > 1. - 9 6 * 6 . 5 - 6 ; 6 . 5 & 1 88 / 2& + 53 ; 0 ) ; & 1 !4 ; 9 -5 )56 2> +=6 3 ; & & ! < ) ; & & !58 ; >6 % A 1@= . .9 % . $ . ,- ; ! 0+* 5 A ; ! 2"1.6 * 3 ; % / ; > ; ?" . 56 ; &9 & ; = > .9 ; . / +=5 ; & ( ; / 5 2 !5 6 3 ; > ) 5 & ( 5 ; ; - ! % 5 ; . 5 4 @6 &9 56 * . ; 0 8 ; & %5 1 6?!9 ; & %5 1 / ( ; +=6 . ; & -5 @ ; B ! 2& 8 > 3 ; & 5 / 6 )56 2+ 5 < 3 1 /+ 0 ; ! # ; )8 ; ;& @ ; & ( ; -5 . @ 1 ; > ( ; - !4 ; %65 4 & > ! ; >6 % A 1@= . .9 % . ; & & 9 ..$ ,- *2 3 @6 0$ 5 9 6 6 5 4 ' 1 ( ; 4 5 .!% - 5 ; / 1. .) ; ; < 1&5 /5 2&!)3 ; / 1!4 . . 5 - . + ; !%) ) ; + 6 5 61> # = $ .= ) ; 0 2. 5 3 ; !9 % !4 ; 6?!9 % @ ; < @ ; <4? & ; <4? ; <4? -7 5 ; <4? % ;<4! ; ( ; ( %6 % ; .6 .6 .6 * &6 %5 ;2@ 63 ; 0 - ; ?<?/ C 5 @66 ) &5 ; 8 & 5 ; * 5 4 ; ) % ; @6 .6 & ; * 4 .9 ! ; ! & . 5 ; - . 5 2 @ - 5 3 ; 6 ! ; !9 ! ; /= .9 ! - ( ; + +% ; ) > & ; / ! & ; @6 .6 0 & D . 5 ; @6 .6 ( & ; 0 % . 5 D .9 / ; % 8 @ ; &*/. ; ) ! ; .% % ; )&+* E 2+= & 3 ; -=8 ?< 2 ?< 3 ; 5 - . ( % ; .91&4 / !" # ! $#!" %& +. % & + 5 Page 205 of 414 5 .(+*) 6$ .+. *+ ,- < - ( 0 - > 5 5 > & 0 ()$ ,- -=8 - ! 1 *.@ % 5 $+ $ ,- ! ! ( %6 ( $ . ,- 1% @ 5 % +)+ 6 1 .+. / ! %5 ( / ! %5 ( &6 @ = % 5 +5 5 @ ( * . += -5 @ (% &5 % 5 $ . ! % & . 8 $.) 6 . 5 + 5 !4 & !4 & !4 & 9 6 / ) & + 5 + 5 /. ! > 2% 5 -5 48 3 %?)% + 5 !6 F + 5 8 ) 1 /7 . $ 0 $ 2 "' 3 - += " 2"" ' 3 - += 2#$' 3 - += ..$ ,- *-. % 1!6 > 5 > > 8 2$ 3 < @ & 9 6 5 > +1& 2( 01@ &5 / 3 > +1& 2> /61@ &5 / 3 > +1& 2> /61@ -6 / 3 ( 0 - 5 0-% # < -6 / 5 F > % 5 1 / + > > & , B += ! B += ! B += ! B += ! *+ .+. *+ ,- - % . % ( 4 ..$ ,- ( )5 5 &9 56 & 2=#3 ? < 2=#3 * . & 5 @ ( (= $ . ,- "( & 1 ! $ @ !% &1 @ 5 - @ !" # ! $#!" %& +. % & + 5 / ! %5 ( & + 5 !4& > +1& 2(01@1 @@ &5 / 3 *-. .. % 1!6 > 5 BBB += ! 0-% # < -6 / 5 F 1% - > 5 5 Page 206 of 414 8 $+ +. *++* *+ +(+ +. 0 / 45?-.@ +. + % 5 & + 5 +. + > 5 & + ) &6 % G @ 1 ) 5 1 H 2!3 # $'$ 2 '3 (I 23 #' 2 #3 & I 23 ' 2$3 % > 'I / 6@856? 5 % @ # 1 4 . @ % 6 @ - & + 04 04 +5 5 56 -7 5 > 2& & 3 J 'K !85 & < . 0 < - @ -1-9% + < % 5 I 7 2!3 ' 2' 3 % & % & @ % . @ ( )4 % - @ .6 - & 2>./3 "$ - ) 1 23 ' 2 3 - & - @ !9 & ) - - & 55 &@/ - - 2/5 3 - . @ + )4 0 L5 @ +5 5 - & ! 1 23 ' 2'3 *.@ - > ! 1 23 ' 2'3 *.@ + +5 5 & & )% ( %6 & ( & & ( = &(B ( )% 0 . * 4 213 $ . +(+ +. & / F #B . # - @ >44 % 1 > % 1 & @ 5 ) MK @ 6 5 -5 2@-3 M & +=5 . / ( & & % % )5 4 -=8 )5 . &6 %5 @ B > @ ) *8 & .6 > 555 2& & 3 J 'K !" # ! $#!" %& +. % & + 5 Page 207 of 414 " . +* .& +* & 8 & 1.6 ?# % N' I @61.6 ? $ % N '$ I @61.6 ?# % N '$ I @61.6 ?#$ % N '$ I " @61.6 "# ? % N '$ I -.. +* 6+$++ /14 0 4' ) ?#$ % " K $?# % " K F #B #$ F #B " F #B " F #B F " #B F " #B ()$ .)-+. 9 ) 1 6 2! 63 - . ! 1 23 .5 ! & 8 "23 K "' 2#'$3 K '" 2' 3 @ - . -9 2%8 O > 3 1 6 2! 63 K ' 2"'3 ' 2 '3 K "' 2'3 P- 55 5 K ' ..$+* & 8 % -9 2! 3 ##' 2 $'$3 % & % 5 2!3 ' 2$'#3 >L5 % (@ ?6 23 #$ 2# 3 56 2H?63 # 2" 3 /= < 8 @ Q- 2Q%3 2 3 /= < 8 @ 2( ) 3 & ( *' $ &&) /= > (5 < 2.3 ' 2 '3 .-6)+. + :)+- & 8 -9 9 5 1 2H ? 3 # 2"'"3 *+ & 8 > + & >./ $ 9 > PP 6 . & ? 2? 3 2#3 (/+. 2.3 23 PP & R+ ) &6 S = 8 . +. &% T/) ' ; ) & 8 +=6 -9 2> < 3 5 2H? 3 2"#'"3 /=' 98 (5 2.3 ' 2''3 +=6 @ 2> < 3 Q- 2Q%3 # 2 3 ) C < 565 5 5 = 8 5 ' ) 5 5 5 ' . 5 5 0 5 .9 & ) ' 5 55 5 9 6 (&# )* ' & 8 1 & ( $"" . 1 & ( $ !" # ! $#!" %& +. % & + 5 @61.6 ? $ %N '$ I Page 208 of 414 0 5 .9 & 5' U &# B' U 6 "$ U 5'5 V 0 5 .9 & 5' 6 4' 55 8L5 56 9 6 5' . *' "$# >4' % ? ? !" # ! $#!" %& +. % & + 5 +-+. &+*9 . /+ < (<0 > @ PP 8% 5 02!3 ! = = 1 23 6 1 8 23 * @ W ' 23 = #' 2 3 = ' 2#"3 " # 2 "3 "# 2 3 ' 23 = #' 2 3 = ' 2$"3 #"$ 2 3 "" 23 ' 23 = #' 2 3 = $' 2 $$3 # $ 23 "## 2 3 ' 23 = #' 2 3 = #' 2""3 # 2 3 " 2" 3 " ' 2"#3 = "' 2"# 3 = #' 2""3 " 2" 3 " 2 "3 " 2"#3 = "' 2"# 3 = $' 2#"3 2"#3 2 $3 ' 2"$ '3 = "' 2"# 3 = ' 2#"3 2#3 # 2"$ 3 $'" 2'3 = "' 2"# 3 = $' 2#"3 " 2" 3 $" 2 3 '$ 2 3 = "' 2"# 3 = $' 2#"3 # 2"#3 & . $.) > @ PP 8 % 5 02!3 ! = = 1 23 6 1 8 23 & * @ W #"' 2" ""3 = '# 2$ 3 = $' 23 # 2 # 3 # 2$"$3 "# 2 3 #"' 2" ""3 = '# 2$ 3 = $' 2$3 2" 3 #$" 2 $3 "" 23 #"' 2" ""3 = '# 2$ 3 = "' 2 #3 $" 2"3 #2"#3 "## 2 3 #"' 2" ""3 = '# 2$ 3 = ' 2 3 $ 2 3 # 2#3 " 2" 3 #"' 2" ""3 = "' 2"# 3 = ' 2# 3 " 2"#$3 2" 3 " 2 "3 #"' 2" ""3 = "' 2"# 3 = ' 2 3 2 3 2#$3 2 $3 ' 2"$ '3 = "' 2"# 3 = ' 23 2" 3 $ 2"3 # 2"$ 3 $'" 2'3 = "' 2"# 3 = ' 2 3 " 2"#$3 2" 3 $" 2 3 '$ 2 3 = "' 2"# 3 = ' 2 3 $ 2"$3 $ 2" 3 $4$ .)+ $.) > @ PP 8% 5 02!3 ! = = 1 23 6 1 8 23 & * @ W $' 2#3 = '# 2$ 3 = $' 2"3 #$ 2 3 # 2$#3 "# 2 3 $' 2#3 = '# 2$ 3 = $' 2 3 $ 2 3 # 2#3 "" 23 $' 2#3 = '# 2$ 3 = "' 2" 3 $ 2 3 #$2"$ 3 "## 2 3 $' 2#3 = '# 2$ 3 = ' 2 3 " 23 # 23 " 2" 3 $' 2#3 = "' 2"# 3 = ' 2 3 $" 2"#$3 2" 3 " 2 "3 ' 2# $'3 = "' 2"# 3 = ' 23 " " 2$$ 3 # 2 #3 2 $3 $'# 2# ""'3 = "' 2"# 3 = ' 2"3 # 2$$3 # 2 3 # 2"$ 3 "#' 2#3 = "' 2"# 3 = ' 23 $" 2"#$3 2" 3 $" 2 3 " "' 2 $'3= "' 2"# 3 = "' 2"" 3 $$" 2# 3 $ 2"3 $4$ ' .)+ $.) &+ -..+= - > @ PP 8% 5 02!3 ! = = 1 23 6 1 8 23 & * @ W #"' 2" ""3 = '# 2$ 3 = ' 2"" 3 #$ 2 "3 #$ 2"3 "# 2 3 #"' 2" ""3 = '# 2$ 3 = #' 2 3 " 2"3 # 2 3 "" 23 #"' 2" ""3 = '# 2$ 3 = ' 2 3 2#3 "" 2#3 "## 2 3 #"' 2" ""3 = '# 2$ 3 = $' 2" 3 "# 2$$#3 " 23 " 2" 3 #"' 2" ""3 = "' 2"# 3 = $' 2" 3 $ # 2" "3 $" 2"" "3 " 2 "3 #"' 2" ""3 = "' 2"# 3 = "' 2"" 3 # 2"3 $" 2 #3 2 $3 ' 2"$ '3 = "' 2"# 3 = "' 2""" 3 $ 23 # 2 3 # 2"$ 3 $'" 2'3 = "' 2"# 3 = "' 2"" 3 $ # 2" "3 $" 2"" "3 $" 2 3 '$ 2 3 = "' 2"# 3 = "' 2"" 3 2# 3 $$ 2" #3 2 $3 $'#2# ""'3 ="' 2"# 3 = ' 2"3 #2$$3 Page 209 of 414 1 OF 2 21 Light Remote Annunciator and Remote Relay Panel GE N E R A T O R C O N T R O L S Part No. 10000026036 Rev. G 10/02/23 The Remote Annunciator Panel provides remote monitoring and annunciation for up to 21 generator and system indications. 21 LEDs indicate 18 generator, 2 system, and 1 programmable condition. The Relay panel has up to 8 selectable functions on form A relays; multiple relay panels can be connected for all 21 generator parameters. 7KHVSHFLȴFIDXOWVFDQEHSURJUDPPHGWKURXJKthe Power Zone® display located on the generator. Communications for a Power Zone® or G8601 equipped generator is RS-485. All models require battery power (+12 or +24 VDC) sourced from the generator battery. The Remote Annunciator Panel complies with NFPA 99 and NFPA 110. Operating Temperature ...............................................................................................................................................................................-25 ºC to 60 ºC Humidity ....................................................................................................................................................................................0 to 95% Non-Condensing Power Supply ...................................................................................................................................................Generator Battery, +12 or +24 Volts DC Power Usage ..................................................................................................................................................................................................6 Watts Typical RS-485 Communications ........................................................................................................................Fully Isolated Twisted Pair Cable with Shield RS-485 Length ..............................................................................................................................................................................................................4,000 ft Relay Output .. One N.O. Contact and 8** N.O. & N.C. Contacts (Energized when Annunciator is Powered and No Faults are Present) Relay Contact Rating ....................................................................................................................................................................................30 VDC, 1 amp Enclosure Rating ........................................................................................................................................................................................................NEMA 1 Alarm Horn (Remote Annunciator Panels Only) ...................................................................................................................................90 dB @ 10 cm Description Model G0098511 Gray Remote Annunciator Panel with 8 Relays Model G0098521 Gray Remote Relay Panel without LEDs and Keypad (Relays only) Model G0098531 Gray Remote Annunciator Panel without Relays *Max Distance Between Hubs - No Limit on Number of Hubs or Total Distance **Only available on Models G0098511, G0098521 (QYLURQPHQWDO6SHFLȴFDWLRQV Model G0098511 Gray Remote Annunciator Panel with 8 Relays Page 210 of 414 Generac Power Systems, Inc. | P.O. Box 8 | Waukesha, WI 53187 3 k*HQHUDF3RZHU6\VWHPVΖQF$OOULJKWVUHVHUYHG$OOVSHFLȴFDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH Part No. 10000026036 Rev. G 10/02/23 21 Light Remote Annunciator and Remote Relay Panel 2 OF 2 GE N E R A T O R C O N T R O L S 1.649.06 0.86 0.812 Dia. 4.53 0.812 Dia. Both Sides11.42 10.24 7.09 8.27 9.64 Outside Four mounting holes for 21 Light Annunciator 4-mm -0.7 Female Thread 1.57 Thru 2.32 1.93 R0.59 Both 0.87 1.42 6.49 Cut Rough Opening 6.75” x 9.88” Function Color Alarm Latched Pre-Low Oil Pressure Yellow Yes Yes Pre-High Water Temperature Yellow Yes Yes Pre-Low Water Temperature Yellow Yes Yes Pre-Low Fuel Yellow Yes Yes Battery Charge AC Fail Yellow Yes No Low Battery Voltage Yellow Yes No High Battery Voltage Yellow No No Not in Auto Red Yes No RPM Sensor Loss Red Yes Yes Overcrank Red Yes Yes Overspeed Red Yes Yes Low Oil Pressure Red Yes Yes High Water Temperature Red Yes Yes Low Water Level Red Yes Yes Emergency Stop Red Yes No Gen Running Yellow No No Gen Power (ATS) Yellow No No Line Power (ATS) Green No No Systems Ready Green Yes No Communications OK Green Yes No Spare Green No No Spare Keypad Switch can be used to implement a remote start function (Models G0098511 and G0098521 only). Surface Mount 7KH/LJKW$QQXQFLDWRUFDQPRXQWWRDȵDWVXUIDFH with connections through the 0.812 inch diameter knockout on the back surface or through 0.812 inch diameter knockouts on sides as shown. Flush Mount This Flush Mount Box is recessed into the wall opening and the surface mount annunciator mounts to the (4) 4 mm screw holes on the back surface. After wire connections are made the front annunciator cover is attached. 5.8 Annunciators All dimensions are in inches. Flush Mount Page 211 of 414 1 OF 1 Part No. A0001726823 Rev. D 03/26/24Generac Power Systems, Inc. | P.O. Box 8 | Waukesha, WI 53187 3 k*HQHUDF3RZHU6\VWHPVΖQF$OOULJKWVUHVHUYHG$OOVSHFLȴFDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH GE N E R A T O R C O N T R O L S REMOTE EMERGENCY STOP SWITCH Break Glass - Power Zone® Pro & Pro Sync, G8601 Generac Part Number: A0000960234 Surface Mount, NEMA 3R 5 Replacement Glasses Aluminum Enclosure Contact Rating: AC-15 3A 240V, DC-13 1.1A 125V Contact Blocks: 3 Compatible Controllers: Power Zone® Pro, Power Zone® Pro Sync, G8601 :LULQJYDULHVE\HQJLQH UHIHUWRXQLWVSHFLȴFZLULQJGLDJUDP 6SHFLȴFDWLRQV Dimensions: mm [in] 141.5 [5.6] 124.7 [4.9] 126.2 [5.0] 72.8 [2.9] 60.4 [2.4] 140.0 [5.5] Page 212 of 414 1 OF 2 DSE® G8601 CONTROLLER GE N E R A T O R C O N T R O L S Part No. A0004103551 Rev. B 04/25/24 Key Features • Advanced PLC Functionality • Multi-Purpose PIDs • Virtual Inputs • On-Screen Mimic (SLDs) • Multiple Application Support • Integral LCD Display Heater • Enhanced High-Resolution 240 x 128 Pixel Display • Single Generator Control • Latest ECU / ECM Support • Support for DSE Panel PC • Zero Sequence Voltage Protection • Integral Gasket (IP65 protection) Standard Protections • Low Coolant Level • High/Low Coolant Temperature • Oil Temperature • Over/Under Speed • Over/Under Voltage • Over/Under Frequency • Over/Under Current • Over Load • Battery Voltage • Battery Charger Current • Phase to Phase and Phase to Neutral Short Circuits (I2T Algorithm) • Ground Fault Features 7KH'6(*LVDJHQVHWFRQWUROOHUZLWKLQWHJUDOKHDWHUGHVLJQHGIRUFRPSOH[SDUDOOHOLQJDSSOLFDWLRQV7KH*FDQEHFRQȴJXUHG to provide paralleling for up to 4,032 generators on a single site and provides a wide range of high-end features for multiple DSSOLFDWLRQHQYLURQPHQWV7KHPRGXOHLVFRQȴJXUDEOHIRUXVHDVDVLQJOHVHWFRQWUROOHUPXOWLVHWFRQWUROOHUPDLQV XWLOLW\ FRQWUROOHURU group controller. Page 213 of 414 2 OF 2 DSE® G8601 CONTROLLER GE N E R A T O R C O N T R O L S Part No. A0004103551 Rev. B 04/25/24 Control Panel • $XWR20DQXDO -Indication Through Display Screen • Audible Alarm and Silence • Not in Auto Indication Voltage Protection • Three Phase Generator Sensing & Protection • Three Phase Bus Sensing • Negative Power Limit • Loss of Sensing Protection • Fault Protection (I2T Function) • High Voltage Limit • Low Voltage Limit • Maximum Power Limit Customer Ports • Ethernet • 2 RS-485 • 2 USB • CANBus Governor Functionality • Speed Control through ECM Integration • Soft Start Ramping (Multiple Steps) 4XDOLȴFDWLRQ7HVWLQJ • Life Test in Environmental Chamber • Storage Temperature Range -40° C to +85° C • Operating Temperature w/o Display Heater -30° C to +70° C • Operating Temperature w/ Display Heater -40° C to +70° C • Vibration Tested and Protected Connections‡ • 7 Analog Inputs • 2 Analog Outputs • 9 Digital Inputs • 12 Digital Outputs • Comms Ports -1 CANbus Port -2 USB Ports -2 RS-485 Ports Codes And Standards • UL 6200 • CE • NFPA 110 Capable More Features • Built-in Governor and AVR Control • Digital AVR Support • Multiple Language Support • Generator Current, Protection & Power Monitoring • &RQȴJXUDEOH7LPHUV • Integrated SNMP • Data Logging • 3&&RQȴJXUDWLRQ • DSENet® (Expansion Support) • Flexible I/O (Inputs/Outputs) • Automatic and Front Panel Breaker Control • Power-Save Mode Generac Power Systems, Inc. | P.O. Box 8 | Waukesha, WI 53187 3 k*HQHUDF3RZHU6\VWHPVΖQF$OOULJKWVUHVHUYHG$OOVSHFLȴFDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH Ȏ$FWXDOΖ20D\9DU\'XHWR&RQȴJXUDWLRQ Page 214 of 414 Part No. 0182630SSD Rev. E 9/3/21 ALTERNATOR DATA SHEET K0200124Y21 60 H z A L T E R N A T O R D A T A 1 OF 2 General Characteristics Base Data at 480V, 250 kVA, 1,800 RPM, 60 Hz, 3Ø Voltage (V)80°C Rise 105°C Rise 120°C Rise 150°C Rise kW kVA kW kVA kW kVA kW kVA 208/240 152 190 182 227 200 250 214 267 480 152 190 182 227 200 250 214 267 Ratings at 0.8 pf based on 40°C Ambient Voltages (V) 208/240 and 480 Number of Leads 12 Frequency (Hz) 60 Winding Type Reconnectable Phases 3 Air Flow (CFM) 1,660 Speed (RPM) 1,800 Total Harmonic Distortion (%) <5 Excitation System PMG Largest Single Harmonic Value (%) <3.5 Insulation Class H Telephone Interference Factor (TIF) <50 Winding Pitch 2/3 Reference Part Number 0L3717E01R Description Value Stator Resistance, Line to Line, High Wye &RQQHFWLRQ 0.0151 5RWRU5HVLVWDQFH 1.0800 ([FLWHU6WDWRU5HVLVWDQFH30* 6.4250 ([FLWHU5RWRU5HVLVWDQFH30* 0.2060 ([FLWDWLRQ:LQGLQJ5HVLVWDQFH30* 1.2824 Xd, Direct Axis Synchronous Reactance (p.u.) 3.360 X2, Negative Sequence Reactance (p.u.) 0.230 X0, Zero Sequence Reactance (p.u.) 0.080 X’d, Direct Axis Transient Reactance (p.u.) 0.190 X”d, Direct Axis Subtransient Reactance (p.u.) 0.170 Xq, Quadrature Axis Synchronous Reactance (p.u.) 1.610 T’d, Direct Axis Transient Short Circuit Time Constant (s)0.103 Description Value T”d, Direct Axis Subtransient Short Circuit Time Constant (s)0.016 T’do, Direct Axis Transient Open Circuit Time Constant (s)2.245 Ta, Short Circuit Time Constant of Armature Winding (s)0.028 Phase Sequence CCW-NDE T1, T2, T3 Voltage Balance, L-L or L-N (%) 2.5 Deviation Factor (%) <7 High Wye Connection, Sustained 3Ø Short Circuit Current (%) - PMG 300 X/R 11 Short Circuit Ratio 0.53 Heat Rejection (BTU/hr) - 100% Rated Load, 480V, 0.8pf, 120oC Temperature Rise 87,807 Reference: Mil-STD-705B All Ratings are Nominal Page 215 of 414 ALTERNATOR DATA SHEET K0200124Y21 Part No. 0182630SSD Rev. E 9/3/21 Generac Power Systems, Inc. | P.O. Box 8 | Waukesha, WI 53187 P: (262) 544-4811 © 2021 Generac Power Systems, Inc. All rights reserved. All specifications are subject to change without notice. 60 H z A L T E R N A T O R D A T A 2 OF 2 skVA LOG LOG Decrement Curve *Rated Power value is rating kW at 120°C Winding Temperate Rise and 0.8pf *Rated Power 480V @ 0.8 PF 480V @ 1.0 PF 208/240V @ 0.8PF 208/240V @ 1.0 PF 20% 79.2 80.3 81.7 82.5 40% 85.5 87.1 86.7 88.2 60% 88.2 90.4 88.6 90.6 80% 88.8 91.6 88.7 91.2 100% 88.6 92.1 88.1 91.2 Efficiencies 10% 15% 20% 25% 30% 35% 480V @ 0.3PF 116 175 246 324 428 552 480V @ 0.6PF 134 200 286 367 478 589 208/240V @ 0.3PF 89 132 185 244 325 396 208/240V @ 0.6PF 99 151 212 275 361 437 100 1000 10000 100000 0.001 0.010 0.100 1.000 10.000 Ou t p u t C u r r e n t ( A ) Time (s) Balanced 3-Phase Short Circuit Decrement & Thermal Damage Current Limit Curves 208V Decrement Curve 480V Decrement Curve 240V Decrement Curve 208V Thermal Damage Curve 480V Thermal Damage Curve 240V Thermal Damage Curve 208V Control System Shutdown 480V Control System Shutdown 240V Control System Shutdwon Page 216 of 414 1 OF 2 GENprotect ™ Seamless Protection for Industrial Power Generators Doc. No 0187980SBY Rev. D 06/13/19 GE N E R A T O R C O N T R O L S GENprotect Operation The design choice of an onsite power system using a Generac Industrial Power Generator assures your emergency power source is protected from unexpected power distribution faults. Typically, a generator will include some type of over-current device, such as a circuit breaker, or be protected by inherent design with the controller protecting the alternator through a protection algorithm. Generac’s GENprotect generator protection system monitors the system current output and protects the alternator with extended security against fault scenarios that could occur within the site’s downstream distribution system. It is a common misconception that the alternator’s main circuit breaker protects the alternator from a short circuit event. The main output breaker protects the cabling and provides a convenient disconnect. The characteristic trip curve for the industry standard thermal magnetic breaker (MCCB, molded case thermal magnetic or solid state) does not coordinate with the thermal damage limitation for an on-site generator. If circuit breakers are used for generator protection, a solid-state circuit breaker with full adjustments (Long Time, Short Time and Instantaneous, LSI) is required to coordinate the breaker protection curve within the generator thermal damage curve. Historically, this limitation was often accepted in system design since failures of the main generator feeder are extremely rare. Most short circuit events happen at a branch circuit, equipment level, where the fault is easily cleared by the smaller down stream breakers. Given the mission critical nature of today’s back-up power applications, it is more desirable to protect the system against even relatively rare failure modes. As generator controllers have become more powerful it is feasible for manufactures to supply coordinated short circuit protection integral to the generator control system, negating the need for a main-line circuit breaker. Generac’s GENprotect alternator protection algorithm monitors the generator output. If this monitoring senses short circuit current in excess of rated amps, GENprotect steps in to provide a controlled and safe approach to breaker coordination and alternator protection. GENprotect first limits the alternator short circuit current level to 300%. By limiting the available fault current, GENprotect extends the time the alternator can maintain fault current resulting in consistent breaker coordination. Without this functionality a line to neutral fault may be at 800% of rated current and need to be cleared within 1.4 seconds. The second function GENprotect performs is I2T thermal protection for the alternator. Since a short circuit event can heat the alternator so rapidly, it is not possible to protect the alternator by monitoring temperature. Instead GENprotect calculates the heat energy of the fault current. When this energy reaches the limits of NEMA MG1, GENprotect trips the generator off-line. This configuration ensures the alternator is protected and the power system is ensured 10 seconds of 300% fault current for breaker coordination. DESCRIPTION • GENprotect is an alternator protection algorithm approved by UL. • Protects alternator from damage due to shorts and electrical faults. • Provides breaker coordination and alternator protection. • Allows for use of multiple circuit breaker choices, including “no” breaker. Page 217 of 414 2 OF 2 Doc. No 0187980SBY Rev. D 06/13/19 Generac Power Systems, Inc. | P.O. Box 8 | Waukesha, WI 53187 P: (262) 544-4811 © 2019 Generac Power Systems, Inc. All rights reserved. All specifications are subject to change without notice. GE N E R A T O R C O N T R O L S The above Figure shows the Generac GENprotect thermal protection curve for use in protection and coordination studies. The alternator Thermal Damage Curve is shown just to the right of the GENprotect protection curve. If the alternator load is greater than the thermal damage protection curve for the alternator, the generator set will trip off-line. For example, an overload current of 110% for 75 seconds causes an overload alarm and will trip the generator off-line, shutting down the engine. GENprotect will provide generator protection over a full range of time and current, from instantaneous faults to overloads lasting several minutes. An advantage of GENprotect over a MCCB is that GENprotect allows for downstream breakers to clear faults without tripping the generator off-line, providing selective coordination with the first level of downstream breakers. GENprotect ™ Seamless Protection for Industrial Power Generators Page 218 of 414 UNIT OPTIONS 2 Page 219 of 414 1 OF 1 Generac Power Systems, Inc. | P.O. Box 8 | Waukesha, WI 53187 3 k*HQHUDF3RZHU6\VWHPVΖQF$OOULJKWVUHVHUYHG$OOVSHFLȴFDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH BATTERY CHARGER 10 amp Part No. A0004734466 Rev. A 07/17/23 GE N E R A T O R C O N T R O L S The Generac 10 amp 12/24 volt battery charger is designed to work with Generac Industrial Controls and the G8601 to provide the ultimate in automatic battery voltage maintenance. 7KHDPSFKDUJHUKDVDXWRPDWLFȵRDWDQGHTXDOL]H control. It precisely monitors the battery’s voltage and automatically activates the correct charging mode. The FKDUJHUDWHLVOLPLWHGDQGFRQWUROOHGWRHɝFLHQWO\DQG safely maintain ideal battery levels under varying conditions. 7KHHTXDOL]HV\VWHPXVHVDFRQWUROFLUFXLWWROLPLW charging current to 10 amps. When battery voltage drops below a preset level, charging current increases to 5 amps and then to the 10 amp charge rate if needed. When the battery reaches maximum charge, the charger VZLWFKHVWRȵRDWPRGHWRVXSSO\MXVWHQRXJKFXUUHQW to maintain the battery at or above 13/26 volts. Battery voltage and charging current are read at the control panel digital display. Battery charger shown from inside of control panel enclosure. Connections are made via an attached harness. 6SHFLȴFDWLRQV 10A Nominal Input 120 VAC Operating AC Line Voltage Range 108 to 132 VAC ΖQSXW$&/LQH)UHTXHQF\ +] Battery Fuse 15 A Nominal Charge Rate 10 A (TXDOL]H9ROWDJH 13.8/27.6 V Float Voltage 13.0/26.0 V &XUUHQW#(TXDOL]HWR)ORDW7UDQVLWLRQ 5 A Battery Under-voltage shutdown 11/22 V LED Indicators Yes AC Line Voltage Green LED Battery Connected and Charging Yellow LED Battery Current Drain 30 mA AC Line Connection Connector Plug Battery Connection Connector Plug Control Connection AC Power Fail Form Relay Form C 2 A Rating &8/5HFRJQL]HG Yes NFPA 110 Compliant Yes AGM Compatible Yes UL1236 Yes CSA 22.2 No. 107 Yes Page 220 of 414 INDUSTRIAL GENSET - BATTERY INDEX Part No. 0161970SBY Rev. U 8/18/25Generac Power Systems, Inc. | P.O. Box 8 | Waukesha, WI 53187 3 k*HQHUDF3RZHU6\VWHPVΖQF$OOULJKWVUHVHUYHG$OOVSHFLȴFDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH BA T T E R Y O P T I O N S 1 OF 1 All batteries are 12V, 6 cell construction, lead calcium type. For 24V systems, batteries are wired in series. X Battery available with electrolyte and installed in genset. * BCI Group Size reference. • Warranty by Exide Corp. • Exide e-mail: tbgna@exide.com • 800-782-7848 National Hot line INDUSTRIAL SPARK-IGNITED GENSETS - AVAILABLE BATTERIES GENERAC PART # Engine System Voltage Battery Quantity 058208 (Group 24F) 077483 (Group 26) 058665 (Group 27F) 061119 (Group 31) 061104 (Group 8D) BT0015A02 (Group 8D) G2.4 12 1 X G4.5 12 1 X X G8.9 12 1 X G9.0 12 1 X X G14.2 24 2 X G21.9 24 2 X G25.8 24 2 X G33.9 24 4 X DIMENSIONS (in) NOMINAL Part Number Group Number* Nominal CCA @ 0° F L W H 058208 24F 525 6.75 10.63 9.00 077483 26 525 6.75 8.25 7.75 058665 27F 700 6.75 12.50 9.00 061119 31 925 6.75 13.00 9.40 061104/ BT0015A00 8D 1,200 11.00 20.80 10.00 BT0015A02 8D 1,400 11.00 20.80 10.00 INDUSTRIAL DIESEL GENSETS - AVAILABLE BATTERIES GENERAC PART # Engine System Voltage Battery Quantity 058665 (Group 27F) 061119 (Group 31) 061104/ BT0015A00 (Group 8D) BT0015A02 (Group 8D) D2.2 Perkins 12 1 X X D3.3 MHI 12 1 X D4.5 FPT 12 1 X D6.7 FPT 100, 130kW 12 1 X D6.7 FPT 150, 175kW 12 2 X D8.7 FPT 24 2 X D10.3 FPT 24 2 X X D12.9 FPT 24 2 X X D12.5 Perkins 24 2 X D15.2 Perkins 24 2 X D16.0 Volvo 24 2 X X D18.1 Perkins 24 2 X D30.6 Perkins 24 2 X X D33.9 MHI 24 2 X X D37.1 MHI 24 4 X X D49.0 MHI 24 4 X X D65.4 MHI 24 4 X X D66 Baudouin 24 4/8** X X D88 Baudouin 24 4/8** X X **Redundant Battery Option D6.7 FPT 150, 175kW 12 2 X Page 221 of 414 Part No.A0004549668 Rev. A 6/20/23 EATON POWER DEFENSETM CIRCUIT BREAKER DATA PD3 FRAME CI R C U I T B R E A K E R S STANDARDS AND CERTIFICATIONS • UL • CSA • IEC (CE) • CB (CCC) DESCRIPTION • Globally accepted molded case circuit breakers • Covers a range of 100A through 600A • Available in standard 80% rating or optional 100% UL rating (1) AVAILABLE FEATURES AND ACCESSORIES ȏ7KHUPDO0DJQHWLFWULSXQLWV ȴ[HGWKHUPDODGMXVWDEOHPDJQHWLF • PXR 10 Electronic Trip Units (LSI) — Shunt Trip ȃ$X[LOLDU\&RQWDFWV — Alarm Contacts All breakers are rated 600V All breakers are 3-Pole PD G 3 3 M 0400 TFA Product Series PD= Power Defense Frame Size 3 = 3 Pole Size 3 = 3-pole 1 OF 3 (1) 100% rating available on LSI trip only (2) Magnetic-only Molded Case Switch available at 400A and 600A Interrupting Ratings F = 25 kA at 480V G = 35 kA at 480V K = 50 kA at 480V M = 65 kA at 480V F = 14 kA at 600V G = 18 kA at 600V K = 25 kA at 600V M = 35 kA at 600V &HUWLȴFDWLRQV Standards G = 80% Rated F = 100% Rated Continuous Current Ratings 0125 = 125A 0250 = 250A 0400 = 400A 0600 = 600A Trip Unit Type Options B2N = PXR 10 LSI TFA = Thermal/ Magnetic KNS = Molded Case Switch (2) Page 222 of 414 Part No.A0004549668 Rev. A 6/20/23 EATON POWER DEFENSETM CIRCUIT BREAKER DATA PD3 FRAME CI R C U I T B R E A K E R S 7+(50$/0$*1(7Ζ&75Ζ381Ζ763')5$0( )L[HG7KHUPDO$GMXVWDEOH0DJQHWLF 0RGXODUȴHOGLQVWDOODEOH EATON#Continuous Current Rating PDG3XTFA30100 0100 PDG3XTFA30125 0125 PDG3XTFA30150 0150 PDG3XTFA30175 0175 PDG3XTFA30200 0200 PDG3XTFA30225 0225 PDG3XTFA30250 0250 PDG3XTFA30300 0300 PDG3XTFA30350 0350 PDG3XTFA30400 0400 PDG3XTFA30500 0500 PDG3XTFA30600 0600 All breakers are rated 600V All breakers are 3-Pole 2 OF 3 Page 223 of 414 Part No.A0004549668 Rev. A 6/20/23 EATON POWER DEFENSETM CIRCUIT BREAKER DATA PD3 FRAME CI R C U I T B R E A K E R S Option Setting 0125 125 A 0250 250 A 0400 400 A 0600 600 A 1 45 A 90 A 160 A 250 A 2 50 A 100 A 175 A 275 A 3 60 A 110 A 200 A 300 A 4 63 A 125 A 225 A 320 A 5 70 A 150 A 250 A 350 A 6 80 A 160 A 275 A 400 A 7 90 A 175 A 300 A 450 A 8 100 A 200 A 320 A 500 A 9 110 A 225 A 350 A 550 A 10 = In 125 A 250 A 400 A 600 A PXR 10 Catalog Number Selection and Maximum Setting (In) Available Continuous Current (Ir) Settings on PXR Electronic Trip Units (/(&7521Ζ&75Ζ381Ζ763')5$0( *PXR 10 - LSI Trip 0RGXODUȴHOGLQVWDOODEOH EATON#Continuous Current Rating PDG3XPXR30125B2N 0125 LSI PDG3XPXR30250B2N 0250 LSI PDG3XPXR30400B2N 0400 LSI PDG3XPXR30600B2N 0600 LSI All breakers are rated 600V All breakers are 3-Pole LOAD-SIDE LUGS - PD3 FRAME BREAKER-FRAME CIRCUIT BREAKER RANGE (A) WIRE TEMPERATURE RATING CIRCUIT BREAKER LUGAWGWIRE 5$1*( 180%(5 OF CONDUCTORS) TORQUETO WIRE GENERAC # EATON# Power Defense - 3 100-225 194°F (90°C) 3-350 (1) 275 in-lb (31 Nm) A0002200434 PDG3X3TA300 Power Defense - 3 250-350 194°F (90°C) 250-500 (1) 375 in-lb (42.37 Nm) A0002200435 PDG3X3TA350 Power Defense - 3 400 194°F (90°C) 3/0-250 (2) 275 in-lb (31 Nm) A0002200436 PDG3X3TA400 Power Defense - 3 450-600 194°F (90°C) 2-500 (2) 375 in-lb (42.37 Nm) A0002200437 PDG3X3TA630 All breakers are rated 600V All breakers are 3-Pole 3 OF 3 *HQHUDF3RZHU6\VWHPVΖQF_32%R[_:DXNHVKD:Ζ 3 k*HQHUDF3RZHU6\VWHPVΖQF$OOULJKWVUHVHUYHG$OOVSHFLȴFDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH PDG3XPXR30600B2N 0600 LSI 0600 600 A Page 224 of 414 *( 1 ( 5 $ 7 2 5 & 2 1 7 5 2 / 6 2) 3DUW1R + *HQHUDF3RZHU6\VWHPV,QF_32%R[_:DXNHVKD:, 3 *HQHUDF3RZHU6\VWHPV,QF$OOULJKWVUHVHUYHG$OOVSHFLILFDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH &22/$17+($7(5237,21 :$779$& >@ >@ >@ 3/$&(6 >@ >@ >@ +26(%$5%72),7 µ,'+26( 3/$&(6 >@ 287/(7 ,1/(7 >@ > @ ',0(16,216 PP>,1&+(6@ 63(&,),&$7,216 92/7$*( 9$& +($732:(5 : ),;('7+(50267$7 ) +($7,1*(/(0(17 ,1&2/2< 0$;,08035(6685( 36, N3D 3/8*1(0$67' 3 Page 225 of 414 1 OF 1 ALTERNATOR STRIP HEATER 120 VAC Part No. 0603480SSD Rev. E 06/14/19 Generac Power Systems, Inc. | P.O. Box 8 | Waukesha, WI 53187 P: (262) 544-4811 © 2019 Generac Power Systems, Inc. All rights reserved. All specifications are subject to change without notice. AL T E R N A T O R S T R I P H E A T E R TYPICAL HEATER LOCATION ON ALTERNATOR • Relay Controlled • 2 Heaters Per Alternator • 150 WATTS Per Heater • 120 VAC Operation • Factory Installed and Wired 120 VAC From Control Relay in High Voltage Connection Box Typical Heater Location on Alternator CONTROL RELAY ENGINE RUN CIRCUIT 120 VAC FROM CUSTOMER CONNECTION TB4 OR LOAD CENTER (IF EQUIPPED) STRIP HEATERS PART NO. 0K2459 WIRING DIAGRAM 1.50” 7.50” 2.44” Page 226 of 414 1 OF 3 EN C L O S U R E GENERATOR ENCLOSURES DESCRIPTION GENERAC POWER SYSTEMS’ generator enclosures provide year-round weather protection for your power equipment. Engineered with functionality and value in mind, the enclosure design benefits are unique in that the enclosures utilize dimensionally matched components for either a weather protective configuration or a sound attenuated/acoustic configuration. With common components used between design, modification and on-site upgrades can be accomplished with ease. The enclosure design offers several benefits over the “standard enclosures” of other manufacturers. Generac’s enclosures have been created with the goal of maximizing the customer’s product performance satisfaction while maintaining the functionality of reducing exterior noise levels and discouraging product tampering. Although others may require a “premium” for a self-enclosed exhaust system, rugged steel panel construction or protective polyethylene washers under all exterior panel fasteners, Generac includes these and several other features on every enclosure configuration. Be sure to compare. Generac Enclosures offer additional design enhancement extras that other “standard enclosures” do not. Doc No. 0163180SBY Rev. E 06/10/19Page 227 of 414 2 OF 3 EN C L O S U R E GENERATOR ENCLOSURES Post-Free Twin Doors Provide Large, Unobstructed Service Access Gasket-Free, Interconnected Roof Panel Joint Drip-Free, Maintenance-Free Heavy Gauge, Stainless Steel, Partial Pin Hinges with Nylon Spacers Durable, Corrosion-Free, Removable Doors Lockable Turn and Tuck Stainless Steel Latch Handle Corrosion-Free, Non- Protruding and Secure Dense, Closed-Cell Foam Insulation with Reflective Silver Mylar Layer Improved Sound Attenuation Without Damaging Effects From Radiant Heat Exposure Two-Point Door Latch System Ensures Proper Seal Preventing Water Ingress and Sound Egress Doc No. 0163180SBY Rev. E 06/10/19Page 228 of 414 Generac Power Systems, Inc. | P.O. Box 8 | Waukesha, WI 53187 P: (262) 544-4811 © 2016 Generac Power Systems, Inc. All rights reserved. All specifications are subject to change without notice. 3 OF 3 EN C L O S U R E Doc No. 0163180SBY Rev. E 06/10/19 GENERATOR ENCLOSURES FEATURES: BENEFITS: Dimensional matching of acoustic and non-acoustic enclosure designs Reduces variation in fuel tank pricing, inventory; removes need to change out fuel tank or retrofit Standardized enclosure components * Ease of retrofit or upgrade to acoustic system; reduced parts inventory, costs Enclosure mounted directly to unit baseframe Simplified delivery and installation with enclosure and unit in single component design Electrostatically painted panels Maximum protection from weather elements 12 or 14 gauge steel based on kW rating Maximum sound attenuation, protection and product life Aluminum Enclosure optional Prevents corrosion in coastal regions Stainless steel door latch and hinge hardware Provides extended component life; maximum protection against rusting Stainless steel door latch strike plate Maximum protection against enclosure paint damage from door latch pin Door hinges utilize slip-pin design Provides quick door removal for full-unit access Polyethylene gasketing under door hinges Additional protection for enclosure paint finish Keyed door latches Protection for equipment and personnel Large removable access doors Ease of maintenance Relocation of access doors Provides improved access to MLCB on all units Redesigned door gasketing Improved sealing quality from sound and weather elements Weather resistant aluminum roof design with drip ledge Provides optimum moisture/rain runoff from unit Cabled and gasketed radiator access cover Provides improved radiator access and additional protection from weather elements Acoustic roof panels manufactured with mechanical retention pins Increased acoustic foam retention within unit Polyethylene washers under all panel fasteners Additional paint finish protection from stainless steel fastener Internally fastened enclosure panels (where possible) Provides streamlined unit appearance Additional roof panel stiffener Added overall compartment rigidity and acoustic foam panel retention Self-enclosed exhaust system Provides safe unit operation; no enclosure hot spots; streamlined unit appearance Discharge air duct has been designed with minimal fasteners Ease of removal and access to exhaust system Stainless steel exhaust band clamps Provides extended component life; ensures proper exhaust seal Drain holes within air ducts Enables maximum water run-off Rodent-proof, tamper proof enclosure design Safety and security for personnel and equipment Redesigned baseframe lifting lugs Ease of unit relocation; prevents compartment damage from lifting straps Up to 200 MPH wind kit options (Contact Factory for Availability) Meets locally enforced wind requirements * Consult Generac Power Systems, Inc. for installation drawings for specific configurations and dimensions. Page 229 of 414 1 OF 1 PAD VIBRATION ISOLATORS Part No. 0166700SBY Rev. D 4/6/20 Generac Power Systems, Inc. | P.O. Box 8 | Waukesha, WI 53187 P: (262) 544-4811 © 2020 Generac Power Systems, Inc. All rights reserved. All specifications are subject to change without notice. IS O L A T O R S STANDARD CAPACITY Size (Inches) Maximum Load Selection at 40 PSI 3 x 24 2,880 Description:Pad prevents equipment rocking by compensating for mismatch of 4 rigid support points to typical wavy floor surface. Pad protects generator from low frequency shocks and high frequency vibrations present in the floor. Pad Eliminates Noise and Reduces Vibration Transmitted From: Engines Transformers Pumps and Piping Steam Generators Crushers Load Capacity Load Capacity-60 Lbs per Square Inch Thickness Standard Thickness-1 Inch Non-Skid Tread Surfaces Resist “Walking” Durable Cork and Neoprene are Oil and Ozone Resistant Page 230 of 414 1 OF 1 Generac Power Systems, Inc. | P.O. Box 8 | Waukesha, WI 53187 P: (262) 544-4811 © 2019 Generac Power Systems, Inc. All rights reserved. All specifications are subject to change without notice. RhinoCoat™ Part No. 0180230SBY Rev. F 11/16/19 UN I T O P T I O N S Generac’s RhinoCoat™ finish system provides superior durability as a standard for all Generac Industrial enclosures, tanks and frames.* Testing Standards Generac’s RhinoCoat™ finished surfaces are subjected to numerous tests. These include: • ASTM D - 1186 - 87..............................................................................................................2.5+ MIL Paint Thickness • ASTM D - 3363 - 92a............................................................................................................Adequate Material Hardness • ASTM D 522 - B....................................................................................................................Resistant to Cracking • ASTM D 3359 - B..................................................................................................................Exceptional Adhesion • ASTM B117 D 1654..............................................................................................................Resistant to Salt Water Corrosion • ASTM D1735 D 1654............................................................................................................Resistant to Humidity • ASTM 2794 93 (2004)..........................................................................................................Exceptional Impact Resistance • SAEJ1690 - UV Specifications...............................................................................................UV Protection In addition to the testing standards above, Generac adds the following test requirements more specific to generator applications: • Resistant to Typical Oils • Resistant to Typical Fuels • Resistant to Typical Antifreeze • Resistant to Distilled Water Primary Codes and Standards *RhinoCoat™ powder coat paint is durable and corrosion resistant however it is not a rust preventative. Generac pretreats all powder coated parts to assist with resistance to corrosion. Page 231 of 414 DRAWINGS 3 Page 232 of 414 Page 233 of 414 Page 234 of 414 Page 235 of 414 Page 236 of 414 4 3 2 1 4 3 1 AB AB 221 8.70[] 0.00[] 195.6 7.70[] 303.5 11.95[] 1922.8 75.70[] 2075.2 81.70[] 2710.2 106.70[] 2862.6 112.70[] 3448.4 135.77[] 3931.5 154.79[] 297.2 11.70[] 104 4.09[] 195.6 7.70[] 76 . 2 3 . 0 0 [] 0. 0 0[] 11 4 3 4 5 . 0 0 [] 15 7 . 7 6 . 2 1 [] 34 9 . 3 1 3 . 7 5 [] 45 7 . 2 1 8 . 0 0 [] 66 0 . 4 2 6 . 0 0 [] 82 3 3 2 . 4 0 [] 97 5 . 4 3 8 . 4 0 [] 10 1 6 4 0 . 0 0 [] 20 3 . 2 8 . 0 0 [] 38 1 1 5 . 0 0 [] 10 1 . 6 [ 4 . 0 0 ] 17 7 . 8 [ 7 . 0 0 ] 53 . 5 [ 2 . 1 1 ] 11 5 5 [ 4 5 . 4 7 ] MO U N T I N G H O L E S W/ O R I S E R S 32 [ 1 . 2 6 ] 12 4 3 [ 4 8 . 9 4 ] MO U N T I N G H O L E S W / R I S E R S 17 . 5 [ . 6 9 ] (1 0 P L C S ) TO P F L A N G E 20 . 6 [ . 8 1 ] (2 P L C S ) TO P F L A N G E 3848.9 151.53[] 37 1 . 4 6 [] 12 5 6 4 9 . 4 5 [] 25 [ . 9 8 ] 100.1 3.94[] 0.00[] 1120.2 44.10[] 1810.3 71.27[] 2500.2 98.43[] 3190.3 125.60[] 3880.3 152.77[] 3980.2 156.70[] 76 . 2 3 . 0 0 [] 0. 0 0[] 91 4 . 4 3 6 . 0 0 [] RE F 14 5 1 . 7 5 7 . 1 5 [] T I T L E BA S E T A N K 7 0 5 G D - G R P E X T IS S U E D A T E : 1 / 2 2 / 1 8 S I Z E C A G E N O D W G N O 10 0 0 0 0 2 6 9 4 7 R E V B N / A SC A L E 0 . 0 3 5 W T - K G 1 2 3 . 0 6 0 S H E E T 1 o f 1 GE N E R A C P O W E R S Y S T E M S O W N S T H E C O P Y R I G H T O F T H I S D R A W I N G WH I C H I S S U P P L I E D I N C O N F I D E N C E A N D M U S T N O T B E U S E D F O R AN Y P U R P O S E O T H E R T H A N F O R W H I C H I T I S S U P P L I E D W I T H O U T TH E E X P R E S S W R I T T E N C O N S E N T O F G E N E R A C P O W E R S Y S T E M S . c G E N E R A C P O W E R S Y S T E M S 2 0 1 3 EL E C T R O N I C A L L Y A P P R O V E D IN S I D E W I N D C H I L L DR A W I N G C R E A T E D F R O M P R O / E N G I N E E R 3D F I L E . E C O M O D I F I C A T I O N T O B E AP P L I E D T O S O L I D M O D E L O N L Y . S H 1/ 1 RE V WI N D C H I L L V E R S I O N I/ N T A N K F I T T I N G P R O V I D I N G F U N C T I O N 1 1 / 2 " N P T C O U P L I N G F U E L S U P P L Y 2 1 / 2 " N P T C O U P L I N G F U E L R E T U R N 3 5 " N P T W E L D F L A N G E E M E R G E N C Y V E N T ( O U T E R ) 4 F U E L S E N S O R F U E L L E V E L 5 2 " N P T W E L D F L A N G E F U E L F I L L 6 5 " N P T W E L D F L A N G E E M E R G E N C Y V E N T ( I N N E R ) 7 2 " N P T W E L D F L A N G E V E N T 8 1 / 2 " N P T F I T T I N G D R A I N 9 1 / 2 " N P T F I T T I N G R U P T U R E B A S I N A L A R M 10 5 G A L S P I L L / F I L L 11 M E C H . F U E L L E V E L 12 2 " N P T W E L D F L A N G E S P A R E P O R T 13 3 / 8 " N P T C O U P L I N G D R A I N TA N K P / N 1 0 0 0 0 0 2 6 9 0 8 TO T A L C A P A C I T Y 2 7 3 0 [ 7 2 1 ] US A B L E C A P A C I T Y 2 6 7 0 [ 7 0 5 ] ES T . D R Y W E I G H T 6 9 6 [ 1 8 6 6 ] CA P A C I T Y S H O W N : L I T E R [ G A L L O N S ] WE I G H T S H O W N : K I L O G R A M S [ P O U N D S ] LE N G T H S H O W N : M M [ I N C H ] NO T E : U L 1 4 2 / U L C - S 6 0 1 L I S T E D 20 . 6 [ 0. 8 1 ] (1 2 P L C S ) BO T T O M F L A N G E 1 12 2 3 6 13 12 9 11 7 4 5 OP T I O N A L 90 % A L A R M 8 RE M O V A B L E S T U B U P CO V E R P L A T E OP T I O N A L TA N K R I S E R S 10 Page 237 of 414 3$ ' 7 + , & . 1 ( 6 6 , 6 2 1 / < $ 5 ( & 2 0 0 ( 1 ' $ 7 , 2 1 3 $ ' 7 + , & . 1 ( 6 6 6 + 2 8 / ' % ( & $ / & 8 / $ 7 ( ' % < $ 1 ( 1 * , 1 ( ( 5 7$ . , 1 * , 1 7 2 & 2 1 6 , ' ( 5 $ 7 , 2 1 7 + ( : ( , * + 7 2 ) $ / / ( 4 8 , 3 0 ( 1 7 ) 8 ( / , ) $ 3 3 / , & $ % / ( $ 1 ' 6 2 , / & 2 1 ' , 7 , 2 1 6 (/ ( & 7 5 , & 3 2 : ( 5 *( 1 ( 5 $ 7 2 5 6 $ / ( 6 6( 5 9 , & ( 3 $ 5 7 6 5 ( 1 7 $ / 6 72 7 $ / : ( , * + 7 /% 6 =$ % $ 7 7 5( & 2 0 0 ( 1 ' ( ' 3 $ ' / $ < 2 8 7 )2 8 1 ' $ 7 , 2 1 : , ' 7 + , 1 + , * + : $ < $ 9 ( -$ & . 6 2 1 9 , / / ( ) / ' , 5 ( & 7 $8 7 + 2 5 , = ( ' ' ( $ / ( 5 ) 2 5 *( 1 ( 5 $ & 3 2 : ( 5 6 < 6 7 ( 0 6 ,1 & )2 8 1 ' $ 7 , 2 1 / ( 1 * 7 + , 1 *( 1 ( 5 $ 7 2 5 3 $ ' ' $ 7 $ *( 1 6 ( 7 % $ 6 ( ) 5 $ 0 ( : , ' 7 + , 1 =$ % $ 7 7 3 2 : ( 5 *( 1 6 ( 7 % $ 6 ( ) 5 $ 0 ( / ( 1 * 7 + , 1 35 2 - ( & 7 1 $ 0 ( '5 $ : , 1 * , 6 3 5 2 9 , ' ( ' ) 2 5 5 ( ) ( 5 ( 1 & ( 3 8 5 3 2 6 ( 6 2 1 / < , 7 ' 2 ( 6 1 2 7 7 $. ( , 1 7 2 & 2 1 6 , ' ( 5 $ 7 , 2 1 $ 1 < 6 3 ( & , ) , & 6 , 7 ( &2 1 ' , 7 , 2 1 6 5 ( ) ( 5 7 2 * ( 1 ( 5 $ 7 2 5 , 1 6 7 $ / / $ 7 , 2 1 ' : * $ < $ % ) 2 5 3 5 ( & , 6 ( ' , 0 ( 1 6 , 2 1 6 2 5 , ( 1 7 $ 7 , 2 1 $1 ' 6 7 8 % 8 3 ' ( 7 $ , / ' 5 $ : , 1 * , 6 1 2 7 7 2 6 & $ / ( $, 5 5$',$725(1' 28 7 *(1(5$725(1' %$ 6 ( ) 5 $ 0 ( ) 2 2 7 3 5 , 1 7 0$ , 1 & , 5 & 8 , 7 % 5 ( $ . ( 5 /2 & $ 7 ( ' 7 2 : $ 5 ' 7 + , 6 6 , ' ( 2 ) 3 ( 5 , 0 ( 7 ( 5 7 < 3 5( & 0 , 1 7 + , & . 1 ( 6 6 ϭϬ ͘ ϴ Η ϭϵ ͘ Ϯ Η Z & Z d K ' E Z d K Z / E ^ d > > d / K E t ' Ϭ ϱ ϰ z ϴ ϵ ϳ Θ Ϭ ϱ ϰ ϱ ϲ ϰ & K Z W Z / ^ / D E ^ / K E ^ ͕ K Z / E d d / K E ͕ E ^d h Ͳ h W d / > ͘ Page 238 of 414 Page 239 of 414 Page 240 of 414 Page 241 of 414 Page 242 of 414 Page 243 of 414 Page 244 of 414 Page 245 of 414 Page 246 of 414 Page 247 of 414 Page 248 of 414 Page 249 of 414 Page 250 of 414 Page 251 of 414 Page 252 of 414 GROUP G SCHEMATIC - DIAGRAM TX CONTROL 600A TRANSFER SW DRAWING #: A0000347536 REVISION: CN-0084844-F DATE: 5/1/24 PAGE 1 OF 6 Page 253 of 414 PAGE 2 OF 6 GROUP G SCHEMATIC - DIAGRAM TX CONTROL 600A TRANSFER SW DRAWING #: A0000347536 REVISION: CN-0084844-F DATE: 5/1/24 Page 254 of 414 PAGE 3 OF 6 GROUP G SCHEMATIC - DIAGRAM TX CONTROL 600A TRANSFER SW DRAWING #: A0000347536 REVISION: CN-0084844-F DATE: 5/1/24 Page 255 of 414 PAGE 4 OF 6 GROUP G SCHEMATIC - DIAGRAM TX CONTROL 600A TRANSFER SW DRAWING #: A0000347536 REVISION: CN-0084844-F DATE: 5/1/24 Page 256 of 414 PAGE 5 OF 6 GROUP G SCHEMATIC - DIAGRAM TX CONTROL 600A TRANSFER SW DRAWING #: A0000347536 REVISION: CN-0084844-F DATE: 5/1/24 Page 257 of 414 PAGE 6 OF 6 GROUP G SCHEMATIC - DIAGRAM TX CONTROL 600A TRANSFER SW DRAWING #: A0000347536 REVISION: CN-0084844-F DATE: 5/1/24 Page 258 of 414 GROUP G WIRING - DIAGRAM TX CONTROL 600A TRANSFER SW DRAWING #: A0000349100 REVISION: CN-0084844F DATE: 5/1/24 PAGE 1 OF 8 Page 259 of 414 PAGE 2 OF 8 GROUP G WIRING - DIAGRAM TX CONTROL 600A TRANSFER SW DRAWING #: A0000349100 REVISION: CN-0084844F DATE: 5/1/24 Page 260 of 414 PAGE 3 OF 8 GROUP G WIRING - DIAGRAM TX CONTROL 600A TRANSFER SW DRAWING #: A0000349100 REVISION: CN-0084844F DATE: 5/1/24 Page 261 of 414 PAGE 4 OF 8 GROUP G WIRING - DIAGRAM TX CONTROL 600A TRANSFER SW DRAWING #: A0000349100 REVISION: CN-0084844F DATE: 5/1/24 Page 262 of 414 PAGE 5 OF 8 GROUP G WIRING - DIAGRAM TX CONTROL 600A TRANSFER SW DRAWING #: A0000349100 REVISION: CN-0084844F DATE: 5/1/24 Page 263 of 414 PAGE 6 OF 8 GROUP G WIRING - DIAGRAM TX CONTROL 600A TRANSFER SW DRAWING #: A0000349100 REVISION: CN-0084844F DATE: 5/1/24 Page 264 of 414 PAGE 7 OF 8 GROUP G WIRING - DIAGRAM TX CONTROL 600A TRANSFER SW DRAWING #: A0000349100 REVISION: CN-0084844F DATE: 5/1/24 Page 265 of 414 PAGE 8 OF 8 GROUP G WIRING - DIAGRAM TX CONTROL 600A TRANSFER SW DRAWING #: A0000349100 REVISION: CN-0084844F DATE: 5/1/24 Page 266 of 414 Page 267 of 414 Page 268 of 414 Page 269 of 414 Page 270 of 414 Page 271 of 414 Page 272 of 414 Page 273 of 414 REFERENCE INFORMATION 4 Page 274 of 414 /HIW5LJKW )URQW %DFN 5$',$725(1' *(1(5$725(1' 3RV 3RV 3RV 3RV *( 1 ( 5 $ 7 2 5 & 2 1 7 5 2 / 6 2) 3DUW1R66' 5HY% *HQHUDF3RZHU6\VWHPV,QF_32%R[_:DXNHVKD:, 3 *HQHUDF3RZHU6\VWHPV,QF$OOULJKWVUHVHUYHG$OOVSHFLILFDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH /(9(/$&2867,&(1&/2685( 6'/,9(&2 1RWHV $OOSRVLWLRQVIW 0 IURPVLGHIDFHVRIJHQHUDWRUVHW *HQHUDWRURSHUDWLQJDWIXOOORDG 7HVWFRQGXFWHGRQDIRRWGLDPHWHUDVSKDXOWVXUIDFH 1RQHQFORVHGVHWVGRQRWLQFOXGHH[KDXVWVRXQGGXULQJWHVWLQJ 0HDVXUHG6RXQG/HYHOV+] 3RVLWLRQ1XPEHU G% $ # 0 H W H U V $FWXDO $YHUDJH $YJG%$ Page 275 of 414 STATEMENT OF EXHAUST EMISSIONS 2025 FPT Diesel Fueled Generator EM I S S I O N D A T A 1 OF 2 Part No. A0006524151 Rev. F 10/7/25 The measured emissions values provided here are proprietary to Generac and it’s authorized dealers. This information may only be disseminated upon request to regulatory governmental bodies for emissions permitting purposes or to specifying organizations as submittal data when expressly UHTXLUHGE\SURMHFWVSHFLȴFDWLRQVDQGVKDOOUHPDLQFRQȴGHQWLDODQGQRWRSHQWRSXEOLFYLHZLQJ7KLVLQIRUPDWLRQLVQRWLQWHQGHGIRUFRPSLODWLRQRUVDOHVSXUSRVHVDQGPD\QRWEHXVHGDVVXFKQRUPD\LWEHUHSURGXFHGZLWKRXWWKHH[SUHVVHGZULWWHQSHUPLVVLRQRI*HQHUDF3RZHU6\VWHPVΖQF The data provided shall not be meant to include information made public by Generac. Generator Model kWe Engine Disp (L) Engine Family Engine Model Rated Engine Power (BHP) Fuel Consumption (gal/hr) Aspiration Rated RPM (3$&HUWLȴFDWH # CARB &HUWLȴFDWH SCAQMD CEP # Emissions Standard Category &HUWLȴFDWLRQ Type 6' 6)3;/'7' )*( % - Turbocharged/ Aftercooled 6)3;/'7'N/A N/A 7LHU 6WDWLRQDU\(PHUJHQF\&Ζ 6' 6)3;/'7' )*( % - Turbocharged/ Aftercooled 6)3;/'7'N/A N/A 7LHU 6WDWLRQDU\(PHUJHQF\&Ζ 6' 6)3;/'7' )*( % - Turbocharged/ Aftercooled 6)3;/'7'N/A N/A 7LHU 6WDWLRQDU\(PHUJHQF\&Ζ 6' 6)3;/'7' )*( $ - Turbocharged/ Aftercooled 6)3;/'7'N/A N/A 7LHU 6WDWLRQDU\(PHUJHQF\&Ζ 6' 6)3;/'*% )*( $ - Turbocharged/ Aftercooled 6)3;/'*%N/A 7LHU 6WDWLRQDU\(PHUJHQF\&Ζ 6' 6)3;/'*% )*( $ - Turbocharged/ Aftercooled 6)3;/'*%N/A 7LHU 6WDWLRQDU\(PHUJHQF\&Ζ 6' 6)3;/'*% )*( $ - Turbocharged/ Aftercooled 6)3;/'*%N/A 7LHU 6WDWLRQDU\(PHUJHQF\&Ζ 6''6( 6)3;/'*6 )+( $ - Turbocharged/ Aftercooled 6)3;/'*6N/A 7LHU 6WDWLRQDU\(PHUJHQF\&Ζ 6' 6)3;/'*6 )+() -282 Turbocharged/ Aftercooled 6)3;/'*6N/A 7LHU 6WDWLRQDU\(PHUJHQF\&Ζ 6''6( 6)3;/'*6 )+() -282 Turbocharged/ Aftercooled 6)3;/'*6N/A 7LHU 6WDWLRQDU\(PHUJHQF\&Ζ 6' 6)3;/'*6 )+( $ - Turbocharged/ Aftercooled 6)3;/'*6N/A 7LHU 6WDWLRQDU\(PHUJHQF\&Ζ 6' 8.7 6)3;/75 )&( $ ( Turbocharged/ Aftercooled 6)3;/75N/A 7LHU 6WDWLRQDU\(PHUJHQF\&Ζ 6' 8.7 6)3;/75 )&( $ ( Turbocharged/ Aftercooled 6)3;/75N/A 7LHU 6WDWLRQDU\(PHUJHQF\&Ζ 6' 8.7 6)3;/75 )&( $ ( Turbocharged/ Aftercooled 6)3;/75N/A 7LHU 6WDWLRQDU\(PHUJHQF\&Ζ 6' 6)3;/75 )$( $( 22.1 Turbocharged/ Aftercooled 6)3;/75 N/A 7LHU 6WDWLRQDU\(PHUJHQF\&Ζ 6'0' 6)3;/75 )$( $( 22.1 Turbocharged/ Aftercooled 6)3;/75 N/A 7LHU 6WDWLRQDU\(PHUJHQF\&Ζ 6'0' 6)3;/ Ζ*5 )%( $( Turbocharged/ Aftercooled 6)3;/ Ζ*5N/A 7LHU 6WDWLRQDU\(PHUJHQF\&Ζ (PLVVLRQV%DVHGRQ(QJLQH3RZHURI6SHFLȴF(QJLQH0RGHO 7KHVH9DOXHVDUH$FWXDO&RPSRVLWH:HLJKWHG([KDXVW(PLVVLRQV5HVXOWV2YHUWKH(3$0RGH7HVW&\FOH Generator Model &2 12[10+&PM *UDPVN:KU *UDPVEKSKU 6'1.40 4.3 0.32 *UDPVN:KU *UDPVEKSKU1.04 3.23 0.24 6'1.40 4.3 0.32 *UDPVN:KU *UDPVEKSKU1.0 3.23 0.24 6'1.40 4.33 0.32 *UDPVN:KU *UDPVEKSKU1.0 3.2 0.22 6'1.40 4.3 0.32 *UDPVN:KU *UDPVEKSKU1.04 4.23 0.24 6'0.8 3.78 0.16 *UDPVN:KU *UDPVEKSKU0.6 2.8 0.12 6'0.8 3.78 0.16 *UDPVN:KU *UDPVEKSKU0.6 2.8 0.1 6'0.8 3.78 0.16 *UDPVN:KU *UDPVEKSKU0.6 2.76 0.12 6''6(1.1 3.71 0.08 *UDPVN:KU *UDPVEKSKU0.82 2.7 0.1 6'1.1 3.71 0.08 *UDPVN:KU 0.89 2.76 0.06 *UDPVEKSKU 6''6(1.1 3.71 0.08 *UDPVN:KU *UDPVEKSKU0.8 2.7 0.1 Page 276 of 414 Generac Power Systems, Inc. | P.O. Box 8 | Waukesha, WI 53187 3 k*HQHUDF3RZHU6\VWHPVΖQF$OOULJKWVUHVHUYHG$OOVSHFLȴFDWLRQVDUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH Part No. A0006524151 Rev. F 10/7/25 STATEMENT OF EXHAUST EMISSIONS 2025 FPT Diesel Fueled Generator EM I S S I O N D A T A 2 OF 2 • The stated values are actual exhaust emission test measurements obtained from an engine representative of the type described above. •9DOXHVEDVHGRQ0RGHWHVWLQJDUHRɝFLDOGDWDRIUHFRUGDVVXEPLWWHGWRUHJXODWRU\DJHQFLHVIRUFHUWLȴFDWLRQSXUSRVHV7HVWLQJZDVFRQGXFWHGLQDFFRUGDQFHZLWKSUHYDLOLQJ(3$SURWRFROZKLFKLVW\SLFDOO\DFFHSWHGE\6&$40'DQGRWKHUUHJLRQDODXWKRULWLHV • No emissions values provided above are to be construed as guarantees of emission levels for any given Generac generator unit. •*HQHUDF3RZHU6\VWHPVΖQFUHVHUYHVWKHULJKWWRUHYLVHWKLVLQIRUPDWLRQZLWKRXWSULRUQRWLFH •&RQVXOWVWDWHDQGORFDOUHJXODWRU\DJHQFLHVIRUVSHFLȴFSHUPLWWLQJUHTXLUHPHQWV •7KHHPLVVLRQSHUIRUPDQFHGDWDVXSSOLHGE\WKHHTXLSPHQWPDQXIDFWXUHULVRQO\RQHHOHPHQWUHTXLUHGWRZDUGFRPSOHWLRQRIWKHSHUPLWWLQJDQGLQVWDOODWLRQSURFHVV6WDWHDQGORFDOUHJXODWLRQVPD\YDU\RQDFDVHE\FDVHEDVLVDQGORFDODJHQFLHVPXVWEHFRQVXOWHGE\WKHSHUPLW DSSOLFDWLRQHTXLSPHQWRZQHUSULRUWRHTXLSPHQWSXUFKDVHRULQVWDOODWLRQ7KHGDWDVXSSOLHGKHUHLQE\*HQHUDF3RZHU6\VWHPVΖQFFDQQRWEHFRQVWUXHGDVDJXDUDQWHHRILQVWDOODELOLW\RIWKHJHQHUDWLQJVHW 6'1.1 3.71 0.08 *UDPVN:KU *UDPVEKSKU0.8 2.7 0.1 6' 0.13 *UDPVN:KU *UDPVEKSKU0.37 2.61 0.097 6'3.4 0.07 *UDPVN:KU *UDPVEKSKU0.4 6' 0.13 *UDPVN:KU *UDPVEKSKU0.37 2.61 0.097 6'1.3 3.80 0.11 *UDPVN:KU *UDPVEKSKU0.67 2.76 0.089 6'0'1.3 3.80 0.11 *UDPVN:KU *UDPVEKSKU1.0 2.80 0.1 6'0'0.70 3.78 0.03 *UDPVN:KU *UDPVEKSKU2.780 0.022 7KHVH9DOXHVDUH/RDG'DWD([KDXVW(PLVVLRQV5HVXOWV Generator Model &2 12[10+&PM *UDPVN:KU *UDPVEKSKU 6' 0.29 *UDPVN:KU *UDPVEKSKU0.63 3.17 0.22 6' 0.29 *UDPVN:KU *UDPVEKSKU0.63 3.17 0.22 6' 0.29 *UDPVN:KU *UDPVEKSKU0.63 3.13 0.21 6' 0.29 *UDPVN:KU *UDPVEKSKU0.63 3.17 0.22 6'0.31 4.93 0.06 *UDPVN:KU *UDPVEKSKU0.23 3.67 0.04 6'0.31 4.93 0.06 *UDPVN:KU *UDPVEKSKU0.23 3.63 0.04 6'0.31 4.93 0.06 *UDPVN:KU *UDPVEKSKU0.23 3.68 0.04 6''6(0.62 *UDPVN:KU *UDPVEKSKU0.46 0.04 6'0.62 *UDPVN:KU 0.46 3.91 0.04 *UDPVEKSKU 6''6(0.62 *UDPVN:KU *UDPVEKSKU0.46 0.04 6'0.62 *UDPVN:KU *UDPVEKSKU0.46 0.04 6'0.20 0.02 *UDPVN:KU *UDPVEKSKU0.14 0.0147 6'0.44 4.42 0.01 *UDPVN:KU *UDPVEKSKU0.33 3.30 0.01 6'0.18 0.01 *UDPVN:KU *UDPVEKSKU0.132 4.78 0.007 6'0.98 3.3 0.02 *UDPVN:KU *UDPVEKSKU0.72 2.46 0.01 6'0'0.98 3.3 0.02 *UDPVN:KU *UDPVEKSKU0.72 2.43 0.01 6'0'0.6 3.98 0.01 *UDPVN:KU *UDPVEKSKU0.441 2.927 0.07 Page 277 of 414 Part No. 0184520SSD Rev. B 03/01/12 Generac Power Systems, Inc. | P.O. Box 8 | Waukesha, WI 53187 P: (262) 544-4811 © 2015 Generac Power Systems, Inc. All rights reserved. All specifications are subject to change without notice. Certification of Quality Generac Power Systems certifies that the products we manufacture have been built and tested in accordance with strict internal and external standards for quality. Our quality management system has been registered with the internationally recognized ISO 9001:2008 standard and our products comply with external standards that include, but are not limited to, CSA, NEMA, EGSA, ISO, and UL. The Generac Quality Management System (GQMS) ensures the highest standards of quality at every level of production, from raw materials to the finished product. This includes receiving inspection, in-process checks, product and process audits, testing, final inspections, and shipping standards. Tests of our products are performed in accordance with our internal procedures and controlled through the GQMS to ensure accuracy and effectiveness. The testing process and product designs comply with external standards which may include, but are not limited to: ISO 8528-5, ISO 3046, NFPA 99, NFPA 110, BS 5514, SAE J1349, and DIN 6271. Generac Power Systems has over one million square feet of manufacturing space and over 2000 employees dedicated to designing and manufacturing power generation equipment in our multiple State of Wisconsin, USA factories. All of our installed and mobile generators are built with pride by our skilled American workforce to ensure our customers receive the quality that they expect from Generac. We are committed to producing quality products for both our internal and external customers. We will continuously improve our processes and diligently measure all aspects of our business. Vice President of Quality Generac Power Systems, Inc. Waukesha, Wisconsin USA Daniel Waschow Page 278 of 414 Installation Reference Guide GENERAL The engine-generator set may be installed outdoors, outdoors on a roof structure, inside a detached structure, or in rooms within or attached to a structure. Wherever the location might be, all applicable codes, standards and regulations must be strictly complied with. SELECTING THE LOCATION Proper planning for correct location of the engine-generator will make the difference between a good installation and a poor one. When planning the location, consider the following factors: ¾The structure on which the engine-generator will rest must be strong enough to provide adequate support. ¾The proposed site must be clean, dry and not subject to flooding. ¾The location must permit noise and vibration to be effectively isolated. It is recommended that all local codes and regulations on noise ordinance be strictly complied with. ¾The site must provide easy access to the engine-generator for maintenance, servicing and repair. ¾The location must permit engine exhaust gases to be piped safely away, to an area where people or animals will not be endangered. ¾The proposed location must permit sufficient cooling and ventilating air flow, with a minimum of 3-5 feet around the engine-generator. ¾The engine-generator must be close to the transfer switch and to connected load circuits, so that wiring and conduit lengths are not excessively long. GENERATOR VENTILATION ¾Locate generator so that clean, cool air is available to the air intake and not blocked by any obstructions. ¾The sides and control panel end should have 60 inches of clearance for servicing and efficient cooling air. ¾Radiator exhaust air shall be free of restrictions to avoid recirculation through the enclosure or room. ALL INSTALLATIONS The engine-generator should be installed in a clean, dry, dust free area, away from corrosive vapors. In addition, the area must allow adequate normal and emergency lighting to be provided. In some installations, a cat walk may be necessary and all switches and breakers in the generator must comply with electrical codes and local codes. p g minimum of 3-5 feet around the engine-generator. Page 279 of 414 Foundation Recommendation SUPPORTING THE ENGINE-GENERATOR A CONCRETE BASE: When designing a concrete base, some guidelines that should be followed are: ¾Pad should be calculated by a licensed engineer and meet national and local codes. ¾The length and width of the concrete base should exceed the length and width of the engine-generator by a minimum of at least 12 inches (0.305 meters) on all sides. ¾The foundation depth should be sufficient to give the concrete base a weight that is equal to the engine-generator set weight. To calculate the depth of the concrete base, the following formula may be used: Depth of Base= W 150 x B x L W=Total wet weight of engine-generator set in pounds (kg). 150= Density of the concrete (pounds per cubic foot). 2400= density of concrete (kilograms per cubic foot). B= Foundation width in feet (meters). L= Foundation length in feet (meters). Suggested mixture of concrete (by volume) is 1:2:3 of cement, sand and aggregate with a maximum four inch (100mm) slump with 28 day compression strength of 3000 psi (200MPa). The concrete base should be reinforced with No. 8 gauge steel wire fabric, or equivalent, horizontally placed on 6 inch (150mm) centers. It is important in some applications to isolate the generator pad from attached structures to minimize vibrations. Page 280 of 414 An alternate reinforcement method is to place No. 6 reinforcing bars on 12 inch (300mm) centers horizontally. Bars should clear foundation surface a minimum of 3 inches (75mm) Page 281 of 414 OFF-LOADING CONSIDERATIONS ¾When offloading equipment with cranes, spreader bars must be used to avoid damage. ¾Refer to the provided weights when sizing and unloading equipment. ¾For lifting the generator set, lift points are provided on the base frame. Shackles and chains of suitable length and capacity must be used and a spreader bar is required to prevent damaging the set. ¾Spreader bar must be wider than the base and enclosure. ¾A forklift can be used to lift the generator and make minor adjustments. Page 282 of 414 Generac Power Systems 5 Year (5C) Extended Limited Warranty for Industrial Standby Generators For the period of warranty noted below, which begins upon the successful start-up and/or on-line activation of the unit, Generac Power Systems,Inc. “Generac” warrants that its Generator will be free from defects in material and workmanship for the items and period set forth below. Generacwill, at its discretion, repair or replace any part(s) which, upon evaluation, inspection and testing by Generac or an Independent Authorized ServiceDealer, is found to be defective. Any equipment that the purchaser/owner claims to be defective must be evaluated by the nearest IndependentAuthorized Service Dealer. Emissions components are excluded from coverage under this extended warranty. Emissions warranty coverage isdetailed in a separate emissions warranty. Warranty Coverage: Warranty coverage period is for Five (5) years or two-thousand (2,000) hours, whichever occurs first. Limited Gearbox Coverage: Guidelines: The following will NOT be covered by this warranty: THIS WARRANTY SUPERSEDES ALL OTHER WARRANTIES, EXPRESSED OR IMPLIED. SPECIFICALLY, GENERAC MAKES NO OTHER WARRANTIES AS TO THE MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. ANY IMPLIED WARRANTIES WHICH ARE ALLOWED BY LAW, SHALL BE LIMITED IN DURATION TO THE TERMS OF THE EXPRESS WARRANTY PROVIDED HEREIN. SOME JURISDICTIONS DO NOT ALLOW LIMITATIONS ON HOW LONG AN IMPLIED WARRANTY LASTS, SO THE ABOVE LIMITATION MAY NOT APPLY TO YOU. GENERAC'S ONLY LIABILITY SHALL BE THE REPAIR OR REPLACEMENT OF PART(S) AS STATED ABOVE. IN NO EVENT SHALL GENERAC BE LIABLE FOR ANY INCIDENTAL OR CONSEQUENTIAL DAMAGES, EVEN IF SUCH DAMAGES ARE A DIRECT RESULT OF GENERAC’S NEGLIGENCE. SOME JURISDICTIONS DO NOT ALLOW THE EXCLUSION OR LIMITATION OF INCIDENTAL OR CONSEQUENTIAL DAMAGES, SO THE ABOVE LIMITATION MAY NOT APPLY TO YOU. THIS WARRANTY GIVES YOU SPECIFIC LEGAL RIGHTS. YOU ALSO HAVE OTHER RIGHTS UNDER APPLICABLE LAW. FOR AUSTRALIA ONLY: Our goods come with guarantees that cannot be excluded under the Australian Consumer Law. You are entitled to a replacement or refund for a major failure and for compensation for any other reasonably foreseeable loss or damage. You are also entitled to have the goods repaired or replaced if the goods fail to be of acceptable quality and the failure does not amount to a major failure. FOR NEW ZEALAND ONLY: Nothing in this warranty statement excludes, restricts or modifies any condition, warranty right or remedy which pursuant to the New Zealand Legislation (Commonwealth or State) including the Fair Trading Practices Act of 1986 or the Consumer Guarantees Act 1993 (“CGA”) applies to this limited warranty and may not be so excluded, restricted or modified. Nothing in this statement is intended to have the effect of contracting out of the provisions of the CGA, except to the extent permitted by that Act, and these terms are to be modified to the extent necessary to give effect to that intention. If you acquire goods from Generac Power Systems or any of its authorized resellers and distributors for the purposes of a business, then pursuant to section 43(2) of the CGA, it is agreed that the provisions of the CGA do not apply. GENERAC POWER SYSTEMS, INC. • P.O. BOX 8 • Waukesha, WI, USA 53187 Ph: (888) GENERAC (436-3722) • Fax: (262) 544-4851 To locate the nearest Independent Authorized Service Dealer and to download schematics, exploded views and parts lists visit our website: www.generac.com Part No. 0J4301 Revision M (/16) Warranty Coverage in Year(s) 1-5 Parts, Labor and Limited Travel Year(s): 1-5 Coverage Year(s): 6-10 Coverage Limited Parts and Labor Limited Parts Only 1.Unit must be registered and proof of purchase available. 2.Any and all warranty repairs and/or concerns must be performed and/or addressed by an Independent Authorized Service Dealer, or branch thereof. Repairs or diagnostics performed by individuals other than Independent Authorized Service Dealers not authorized in writing by Generac will not be covered.3.This Warranty is transferable between ownership of original install site. 4.Generac supplied engine coolant heaters (block-heaters), heater controls and circulating pumps are only covered during the first year of the warranty provision.5.Generac may choose to repair, replace or refund a piece of equipment in its sole discretion. 6.Enclosures are warranted against rust for the first year of ownership only. Damage caused after receipt of generator is the responsibility of the owner and is not covered by this warranty. Nicks, scrapes, dents or scratches to the painted enclosure should be repaired promptly by the owner. 7.Warranty only applies to permanently wired and mounted units. 8.Damage to any covered components or consequential damages caused by the use of a non-OEM part will not be covered by the warranty. 9.Proof of performance of all required maintenance must be available.10.Travel allowance is limited to 300 miles maximum and seven and one half (7.5) hours maximum (per occurrence, whichever is less) round trip from the nearest Independent Authorized Service Dealer. Any additional travel required will not be covered.11.Engines, driven components and fuel tanks used in Generac’s standby power products system can carry a separate manufacturer’s (OEM) warranty (the “OEM Warranties”), unless otherwise expressly stated. OEM Warranties are in addition to this Warranty. All warranty claims for defects in material and/or workmanship on Generac product OEM components, may be directed through the OEM distributor/dealer network. OEM Warranties may vary and are subject to change. Generac shall have no liability under OEM warranties. 1.Costs of normal maintenance (i.e. tune-ups, associated part(s), adjustments, loose/leaking clamps, installation and start-up). 2.Damage/failures to the generator caused by accidents, shipping, handling, or improper storage.3.Damage/failures caused by operation with improper fuels, speeds, loads or installations other than what’s recommended or specified by Generac Power Systems. 4.Damage to the generator due to the use of non-Generac parts and/or equipment, contaminated fuels, oils, coolants/antifreeze or lack of proper fuels, oil or coolants/antifreeze. 5.Failures due to normal wear and tear, accident, misuse, abuse, neglect, improper installation, improper sizing, or rodent, reptile, and/or insect infestation.6.Rental equipment used while warranty repairs are being performed and/or any extraordinary equipment used for removal and/or reinstallation of generator (i.e. cranes, hoists, lifts, et. al.). 7.Planes, ferries, railroad, buses, helicopters, snowmobiles, snow- cats, off-road vehicles or any other mode of transport deemed not standard by Generac. 8.Products that are modified or altered in a manner not authorized by Generac in writing. 9.Starting batteries, fuses, light bulbs, engine fluids and any related labor.10.Steel enclosures that rust as a result of improper installation, location in a harsh or salt water environment, or are scratched where the integrity of applied paint is compromised. 11.Units sold, rated or used for "Prime Power", "Trailer Mounted" or "Rental Unit" applications as defined by Generac. Contact an Independent Authorized Service Dealer for definitions. 12.Shipping costs associated with expedited shipping. 13.Additional costs for overtime, holiday or emergency labor costs for repairs outside of normal business hours. 14.Any incidental, consequential or indirect damages caused by defects in materials or workmanship, or any delay in repair or replacement of the defective part(s). 15.Failures caused by any act of God or external cause including without limitation, fire, theft, freezing, war, lightning, earthquake, windstorm, hail, water, tornado, hurricane, or any other matters which are reasonably beyond the manufacturer’s control. Page 283 of 414 13-1 EmsnWrnty003 Rev. A 09/11 United States Environmental Protection Agency Warranty Statement (Stationary Emergency Compression-Ignition Generators) Warranty Rights, Obligations and Coverage Your emission-related warranty covers only components whose failure would increase an engine’s emissions of any regulated pollutant where they are designed, built, and equipped to be free from defects in materials and workmanship under applicable regulations of sec- tion 213 of the clean air act. To receive information about how to make an emission-related warranty claim, and how to make arrange- ments for authorized repairs call 1-800-333-1322 or www.generac.com. Emission- related warranty claims may be denied without proof of proper maintenance or use, accidents beyond the control of the manufacturer, or act of God. Proper maintenance is specified in the Owner’s Manual. Usage is limited to stationary emergency operations and 100 hours per year for maintenance and readiness testing. The warranty period begins when the engine is placed into service. Warranty periods for compression ignition engines greater than 25 horsepower is five years. This warranty is applicable to compression-ignition generator models; equal to and larger than an SD80 starting 1/1/2011, equal to and larger than an SD35 starting 1/1/2012, and all compression-ignition generator models starting 1/1/2013. Important Note This warranty statement explains your rights and obligations under the Emission Control System Warranty, which is provided to you by Generac pursuant to federal law. Note that this warranty shall not apply to any incidental, consequential or indirect damages caused by defects in materials or workmanship or any delay in repair or replacement of the defective part(s). This warranty is in place of all other warranties, expressed or implied. Specifically, Generac makes no other warranties as to the merchantability or fitness for a particular purpose. Any implied warranties which are allowed by law, shall be limited in duration to the terms of the express warranty provided herein. Some states do not allow limitations on how long an implied warranty lasts, so the above limitation may not apply to you. Warranty Page 284 of 414 DEP Form: 62-761.900(2) Form Title: Storage Tank Facility Registration Form Effective Date::ĂŶƵĂƌLJϮϬϭϳ IncorporatedinRule62-761.400, F.A.C. Department of Environmental Protection 2600 Blair Stone RoadiTallahassee, Florida 32399-2400 Storage Tank Facility Registration Form Review Registration Instructions Before Completing this Form Submit this completed form for the facility when registration of storage tanks or compression vessels is required by Chapter 376.303, Florida Statutes Please check all that apply:New Registration New Owner Existing Facility Info Update/Correction Existing Owner Info Update/Correction New Tanks Existing dĂŶŬ Info Update/Correction A.FACILITY INFORMATION County: DEP Facility ID: Facility Name: ______________________________________________________ Facility Address:___ Facility Contact:___ Facility Type(s): City: Zip: ƵƐŝŶĞƐƐWŚŽŶĞ͗ Financial Responsibility Mechanism (choose): Insurance Other 24 Hour Emergency Contact: Emergency Phone: B. TANK OWNER INFORMATION: Identify individual(s) or Business(es) responsible for payment of Registration Fees at the facility location named above Company/Individual Name:Ownership Effective Date:_________________ Mail Address:STCM Account Number (if known):___________ City, State, Zip: ______________________________________________________________________________________________ Contact Person:______________________________________________________________________________________________ Telephone: ________________________ Email Address: ____________________________________________________________ ͘PROPERTY OWNER INFORMATION:Identify individual(s) or entity that if vested with ownership, dominionor legal or rightful title to the real property ompany/Individual Name: ____________________________________________Ownership Effective Date: ___________________ Mail Address: _______________________________________________________________________________________________ City, State, Zip: ______________________________________________________________________________________________ Contact Person:_____________________________________________________________________________________________ Telephone: ________________________ Email Address:____________________________________________________________ ͘TANK/VESSEL INFORMATION:Complete one row for each storage tank or compression vessel system located at this facility (see Registration Instructions for ĐŽĚĞƐ) dĂŶŬ/T or V A or U Capacity InstallĂƚŝŽŶĂƚĞContentŽĚĞStatusEffective Date onstruction Piping Monitoring 1 2 3 4 5 6 7 8 Certified Contractor (performing UST installation or removal): ___________________________________ DBPR License No.: _____________________ Facility Registration Certification:To the best of my knowledge and belief, all information submitted on this form is true, accurate and complete. Signature Date Printed Name _______________________________________________________ Title Submit this form to tankregistration@dep.state.fl.us T A G U C, M, P, I N, A Q, F, R N/A N/A Page 285 of 414 Page 286 of 414 Page 287 of 414 Page 288 of 414 Page 289 of 414 NOT needed for Aboveground Tanks Page 290 of 414 ATS/SWITCHGEAR INFORMATION 5 Page 291 of 414 ! " # $%& "' ( ) ( * + % , , -, . / ' % , , $0 1 22 $% 1 1 1! 1. 3 4 5 + 6 7 6 8 9 6 : 9 6 : + 7 + ; + : 6 9 <6 + 9 : 6 6 9 6 < 6 6 7 : ,* + 7 7 9 : < 6 + + 8 68 + + 9 6 : 6 7 6 9 + 6 : 5 $6 = - !!11!. >! 9 % ' ? + ?( * + Page 292 of 414 ! " ! #!! $ 0 ' % + & ) ' 0 & / 6 % + > *6 7 % + & 6 % + ) % 3 ,*7> * + + * & * + & * 9 6 & = ( ) & + ) 8 9 > & 6 @ ' - A ( 7# B C. B0 D7! B 1 BE '96 > % % + 5 / ' F "' % < + ) ) = 9 ) D!#*E 3 ) ! G / + %&$ #! !'"! ( !)# - (9 $ % + - (9 0 ; + $ % + 6 = $ % + ; 9 , ) ") !7 "7 & )#) $ &"*" ) D! 0 E > D% 9 E 3 )#) $ )*" % + ) 6 D 9 H , E 3% + & 3 ' & &$ 0 6 ' % $ 0 > > + > 8 I ) ' 6 + ' > + > 8 6 & %9 $ 9 6 + 3 > + > 8 6 -> % + * * 0 - '; % ' ' 8 0 $ ( * + 6 * + 0 6 7 %9 + , 6 %< I * + /8 + >8 + & + 5 #. "7/ + + 6 F 6 % )$ +$! &*)& * + $ D *$E ) * * + $ ' "' 86 9 D "' % E ) & ( + D "' % E %< 6 ) J( > & ) = # ' + ( # ( + ) ) ! G %< , / + C G > , / + C G %< , / + 1 G %< , / + G %< , / + !#)!! ! &*)& D E & 3 ' 3 % + &%! )& ,) #. F "7/ + F 9 % ' ? + ?( * + Page 293 of 414 3 + ) : K #C /!2!2 /G: C2 K /8 /) C".2 K : L!!C 3 + ) : 9 : 6M : $: !.#" '9: * #J2J!!C 9 % ' ? + ?( * + ") )-!)&. / ! 0 0 & 0 1 0 1 2 * 1 3 * 4556 D*E ":" D""2E ":" D""2E > D*E !:1 D1E !:1 D1E D*E !":! DC2E !":! DC2E * D*E !":# DC2#E !":# DC2#E % D*E !#:. D!2E !#:. D!2E 0 D*E #1:! D22E #1:! D22E 3 D*E #.: D!"#E #.: D!"#E D*E #:" D#.E #:" D#.E N D*E 2:1 D11E 2:1 D11E F D*E 2:C D1E 2:C D1E , D*E 1!:C D.#E 1!:C D.#E & D*E C:. D#.E C:. D#.E $ D*E 1:! D.!E 1:! D.!E D*E .:! D!.E .:! D!.E ' D*E 2:C D!#!E 2:C D!#!E D*E 1:2 D#CCE 1:2 D#CCE 7 $ 1C B / D!E 7 !J D!E 7 !J $ / , ; 6J D$E #C DC:.E #C DC:.E 6+J, 1C B / D!E 1C 7 ! D!E 1C 7 ! 6+J, / , ; 6J D$E ! DC:.E ! D1E $ D.E 7 # DE !C 7 J D.E 7 # DE !C 7 J $ / , ; 6J D$E "1C D":E "1C D":E 3 DE "C 7 DE "C 7 3 / , 6J D$E !1C D":E !1C D":E 8 496 / !I = ##C D!:.E"I = #C D!:2E #.C D!!E "$ : ; ' 9 % D8E DE - #. "C - 5 < +: + : 3 + ) * : 1 * Page 294 of 414 & & Page 295 of 414 'HFHPEHU $QWKRQ\%RQDYLUH=36 &LW\RI2FRHH &LW\RI2FRHH3URSRVHG3'EXGJHW 62 5HY 6RXUFHZHOO&RQWUDFW *15 :($5(3/($6('722))(57+()2//2:,1*(67,0$7()25<285352-(&7 !" #$ % & %' (') %' $ *! +,-#./- 0/ -#.1 10 $ !# $ $2 ( % ! $ 6' 6WDWLRQDU\(PHUJHQF\6WDQGE\UDWHG N:5DWLQJ 9$&WKUHHSKDVH+] 'LHVHO 30* /HYHO$FRXVWLF(QFORVXUH6WHHO '6(*'LJLWDO*HQVHW&RQWUROOHU DPSUDWHG/6,(OHFWURQLF0/&% ZVWGIDFWRU\OXJV ZVKXQWWULS DX[FRQWDFWV $PS%DWWHU\&KDUJHU %DWWHU\EDWWHU\UDFN FDEOHV JDOORQ8/':VXEEDVHWDQN DSSUR[KUUXQWLPH#IXOOORDG (PHUJHQF\YHQW )'(3FRPSOLDQWZ&&KDQQHO &RRODQW+HDWHU 3DGW\SHLVRODWRUVORRVH /LJKW$QQXQFLDWRU±6XUIDFH )OXVK0RXQW$QQXQFLDWRU.LW 5HPRWH(PHUJHQF\6WRS6ZLWFKEUHDNJODVVVKLSSHGORRVH 6WGVHWRI0DQXDOV 8/ (3$&HUWLILHG !/ - ') ( *!+,-#./- 0/ -#.1 10 $ !# $ $2 ( % 3KRQH (PDLO VDOHV#]DEDWWFRP :HEVLWH KWWS ZZZ]DEDWWFRP 3DJH Page 296 of 414 ! $ 7;6HULHV 5DWHGDW$PS 9ROW3KDVH3ROH 6HUYLFH(QWUDQFH5DWHG $X[LOLDU\FRQWDFWV 6LJQDOEHIRUHWUDQVIHU 3URJUDPPDEOHH[HUFLVHU 6WULSKHDWHU 1(0$5(QFORVXUH 3 0# ,3..4#/0 5HPRWHPRQLWRULQJV\VWHP (PDLOWH[WDOHUWVIRUVHOHFWHGDODUPV &HOOXODUFRQQHFWLYLW\ 3DVVZRUGSURWHFWHG:HE3RUWDOIHDWXULQJUHDOWLPHVWDWXVDQGDFFHVVWRZHHNKLVWRULFDO GDWD 5HPRWHVWDUWVWRSFDSDELOLW\ ,QFOXGHVSDUWVODERUSURJUDPPLQJDQGWUDLQLQJ <HDUZDUUDQW\ IURPGDWHRILQVWDOO 6LPFDUG IRUFHOOXODUPRQLWRULQJ ,QFOXGHV2QH\HDURIFHOOXODUVHUYLFH UHFXUULQJIHHWKHUHDIWHU 1RWH +DUGZLUHG(WKHUQHWFDEOHIURPFXVWRPHUQHWZRUNWRHTXLSPHQW SDQHOLVQRWLQFOXGHG .#00/ 35 1)3$2Q6LWH6WDUW8SDQG7HVWLQJ +RXU5HVLVWLYH/RDG%DQN7HVW 3HUIRUPHG2QVLWH <HDU4XDUWHUO\0DLQWHQDQFH$JUHHPHQWFRQVLVWVRI 0DMRUDQG 0LQRUYLVLWVSHU\HDU )2%2ULJLQIXOOIUHLJKWDOORZHGWRILUVWGHVWLQDWLRQ +/44/ -6 *HQHUDWRU &RPSUHKHQVLYH<HDU:DUUDQW\ IURPGDWHRISHUIRUPLQJVWDUWXS $76 6WDQGDUG<HDU:DUUDQW\ IURPGDWHRIVKLSPHQWIURPIDFWRU\ -783003+# "# 3-# 05 )XHO &RQFUHWH3DG (OHFWULFDODQG0HFKDQLFDO,QVWDOODWLRQ 'LVWULEXWLRQSDQHODQGFLUFXLWEUHDNHUV 1RW$+&$&RPSOLDQW 3KRQH (PDLO VDOHV#]DEDWWFRP :HEVLWH KWWS ZZZ]DEDWWFRP 3DJH Page 297 of 414 35,&( 9:&:;<*/== 2 - > %XLOWLQGLVFRXQWRIKDVEHHQDSSOLHGWRHVWLPDWHIRUSD\PHQWVWKDWDUHUHPLWWHGDVFDVKFKHFN()7RUZLUH WUDQVIHU ( ' '=$ &2 $= ''& ( = $2 ( %< ? 2@A $0 $- 1 'RHVQRWLQFOXGHWUDQVLWWLPH/HDGWLPHLVHVWLPDWHGDQGVXEMHFWWRFKDQJH 3KRQH (PDLO VDOHV#]DEDWWFRP :HEVLWH KWWS ZZZ]DEDWWFRP 3DJH Page 298 of 414 &203/,$1&(5(9,(: =DEDWW3RZHU6\VWHP¶VHVWLPDWHWRSURYLGHWKHVWDQGE\JHQHUDWRUSDFNDJHPHHWVRUH[FHHGVWKHLQWHQWRIWKH VSHFLILFDWLRQVHFWLRQVSURYLGHGZLWKWKHH[FHSWLRQRIWKHIROORZLQJ 1RHQJLQHHULQJVSHFLILFDWLRQSURYLGHG(OHFWULFDO 2QH/LQH'LDJUDPQRWSURYLGHG$OOGLPHQVLRQVDUHDSSUR[LPDWHIRUHVWLPDWLQJSXUSRVHV21/< 5HTXHVW LQVWDOODWLRQGUDZLQJV =DEDWWLVDQHTXLSPHQWVXSSOLHU,WLVWKHUHVSRQVLELOLW\RIWKH6SHFLI\LQJ(QJLQHHU ,QVWDOOLQJ&RQWUDFWRURU(QG8VHUWRHQVXUHWKDWWKHHTXLSPHQWLVVHOHFWHGDQGLQVWDOOHGLQDFFRUGDQFHZLWK/RFDO DQG1DWLRQDOFRGHV &+$1*(6&$1&(//$7,216 5(78516 $Q\RUGHURUFRQWUDFWPD\EHFDQFHOOHGE\WKHFXVWRPHURQO\XSRQWKHSD\PHQWRIUHDVRQDEOHFKDUJHVDQG H[SHQVHVLQFXUUHGE\=DEDWWRQRUEHIRUHWKHGDWHRIUHFHLSWE\=DEDWWRIVDLGQRWLFHRIFDQFHOODWLRQ6XFK UHDVRQDEOHFKDUJHVDQGH[SHQVHVPD\LQFOXGHEXWDUHQRWOLPLWHGWRDQ\FDQFHOODWLRQFKDUJHVLQFXUUHGE\=DEDWW IRUWKHFDQFHOODWLRQDQGRUDQ\OLDELOLWLHVIRURUGHUVRUFRPPLWPHQWVIRUPDWHULDOVRUVHUYLFHVSUHYLRXVO\RUGHUHGE\ =DEDWWLQFRQQHFWLRQZLWKWKHFDQFHOOHGFXVWRPHURUGHURUFRQWUDFW1RPDWHULDORUSURGXFWPD\EHFDQFHOOHGRU UHWXUQHGIRUFUHGLWZLWKRXWILUVWREWDLQLQJWKHZULWWHQDSSURYDORIDQGDWWKHVROHGLVFUHWLRQRI=DEDWW$OOVKLSSLQJ FRVWVRQUHWXUQHGPDWHULDOPXVWEHSUHSDLGE\WKHFXVWRPHU$FFHSWHGUHWXUQVDUHVXEMHFWWRWKHFKDUJHVWHUPV DQGUHTXLUHPHQWVQRWLILHGLQZULWLQJWRWKHEX\HU ZKLFKPD\LQFOXGHZLWKQROLPLWDWLRQVRUH[FHSWLRQVD UHVWRFNLQJIHH '(/,9(5<6+,30(176 &/$,06 WRLQFOXGH:DUUDQW\ $OOFKDUJHVIRUZRUNSHUIRUPHGGXULQJWKHZDUUDQW\SHULRGDUHWKHUHVSRQVLELOLW\RIWKHFXVWRPHUXQWLODSSURYHGE\ WKHDSSURSULDWHZDUUDQW\DXWKRULW\:DUUDQWLHVDUHVXEMHFWWRWKHPDQXIDFWXUHU¶VJXLGHOLQHV(YHQWKRVHZDUUDQW\ FODLPVZKLFKDUHDSSURYHGPD\QRWLQFOXGHRIWKHUHSDLUVRUSDUWV WKHFXVWRPHULVUHVSRQVLEOHIRUFKDUJHV H[FOXGHGIURPZDUUDQW\&RQWLQJHQF\SD\PHQWDUUDQJHPHQWVPXVWEHPDGHSULRUWRDQ\ZDUUDQW\ZRUNEHLQJ SHUIRUPHG%DWWHULHVRLOFRRODQWILOWHUVDQGDGMXVWPHQWVDUHQRWFRYHUHGDVSDUWRIZDUUDQW\UHSDLUVDQGZLOOEH ELOOHGWRWKHFXVWRPHUDWDSSURSULDWHUDWHV 35,&( 0,1,080%,//,1* 3ULFHVKDOOEHLQDFFRUGDQFHZLWKUDWHVFXUUHQWO\LQHIIHFWDWWKHWLPHWKHHVWLPDWHLVUHFHLYHGDQGVKDOOH[SLUHRQWKH GDWHGHVFULEHGLQVDLGHVWLPDWH$OOHVWLPDWHVIRUVHUYLFHVSDUWVHTXLSPHQWDQGODERUZLOOEHLVVXHGLQZULWLQJDQG KDYHDV\VWHPJHQHUDWHGHVWLPDWHQXPEHU9HUEDOHVWLPDWHVDUHQRWYDOLGDQGVKRXOGQRWEHDFFHSWHG$VLJQHG FRS\RIWKHHVWLPDWHPXVWEHRQILOHEHIRUHDQ\ZRUNFDQEHSHUIRUPHG6LJQDWXUHRQVDLGHVWLPDWHVKDOOVHUYHDV WKHFXVWRPHU¶VDFFHSWDQFH=DEDWW¶VELOOLQJJXLGHOLQHVDQGUDWHV/DERUSULFHVRQHVWLPDWHVDUHJRRGIRUDSHULRGRI ILIWHHQGD\VIURPWKHGDWHRILVVXHXQOHVVRWKHUZLVHVSHFLILHG3DUWVDQGHTXLSPHQWSULFHVDUHVXEMHFWWR FKDQJHDQGELOOHGDWWKHFXUUHQWSULFHDWWKHWLPHRISXUFKDVHXQOHVVRWKHUZLVHVSHFLILHG$OOUHJXODUVHUYLFHFDOOV DQGHPHUJHQF\FDOOVZLWKLQQRUPDOKRXUVZLOOEHELOOHGIRUDPLQLPXPRIRQHKRXURIODERUDQGWHQPLOHVRIWUDYHO$OO HPHUJHQF\DIWHUKRXUFDOOVZLOOEHELOOHGIRUDPLQLPXPRIIRXUKRXUVODERUDQGWHQPLOHVRIWUDYHO &5(',7 3$<0(177(506 &RPPHUFLDOFXVWRPHUVZKRKDYHQRWHVWDEOLVKHGDFUHGLWDFFRXQWZLWK=DEDWWPXVWPDNHSD\PHQWDUUDQJHPHQWV EHIRUHJRRGVDUHGHOLYHUHGRUDWHFKQLFLDQLVGLVSDWFKHG1RFUHGLWWHUPVZLOOEHH[WHQGHGWRHQGXVHUV:HFDQQRW DFFHSWSD\PHQWRQVLWHEXWPXVWKDYHDVLJQHGFUHGLWFDUGDXWKRUL]DWLRQRQILOHLQRUGHUWRSHUIRUPDQ\VHUYLFHZRUN 3KRQH (PDLO VDOHV#]DEDWWFRP :HEVLWH KWWS ZZZ]DEDWWFRP 3DJH Page 299 of 414 RQQHZDFFRXQWV1RZRUNZLOOEHSHUIRUPHGIRURUSURGXFWGHOLYHUHGWRFXVWRPHUVZKRDUHRQFUHGLWKROG7KLVKROG LQFOXGHVDQ\HPHUJHQF\UHSDLUVDQGZDUUDQW\ZRUNWKDWPD\EHUHTXLUHG$FFRXQWPXVWEHSDLGLQIXOORUDOWHUQDWH PHDQVRISD\PHQWPXVWEHFRRUGLQDWHGDQGDSSURYHGEHIRUHZRUNLVSHUIRUPHGRUSURGXFWLVGHOLYHUHG6HUYLFH 5DWH'HILQLWLRQVDQG&RQGLWLRQVDUHDYDLODEOHDVDVHSDUDWHGRFXPHQW $*5((0(17 7KLVDJUHHPHQWFRQVLVWVRIDQGLVOLPLWHGWRDTXDOLILHGWHFKQLFLDQSHUIRUPLQJVFKHGXOHGPDLQWHQDQFHLQ DFFRUGDQFHZLWKWKHPDQXIDFWXUHU VUHFRPPHQGDWLRQV=DEDWW,QFZLOOQRWEHKHOGOLDEOHIRUGDPDJHVWRWKH HTXLSPHQWRUSURSHUW\DVDUHVXOWRIHTXLSPHQWIDLOXUHFDXVHGE\DQ\RIEXWQRWOLPLWHGWRWKHIROORZLQJ FLUFXPVWDQFHV LPSURSHURUXQDXWKRUL]HGRSHUDWLRQ QRUPDOZHDUDQGWHDURUGDPDJHGXHWRRYHUORDGLQJ YDQGDOLVP WKHIWRUDFWVRIDWKLUGSDUW\ DFWVRIQDWXUH IDLOXUHWRSHUIRUPVHUYLFHVGXHWRKD]DUGRXVFRQGLWLRQVDQGRWKHUFDXVHV EH\RQGWKHFRQWURORI=DEDWW,QF % $ = ' ( % = ) ( B 2 C $$ ($ &LW\RI2FRHH 62 #$'HFHPEHU BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 6LJQDWXUHRI=DEDWW5HSUHVHQWDWLYH $QWKRQ\%RQDYLUH=36 WRQ\ERQDYLUH#]DEDWWFRP BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 'DWH BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB &LW\RI2FRHH $XWKRUL]HG6LJQDWXUH BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 3ULQWHG1DPH BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 'DWH BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 325HIHUHQFH1XPEHU 3KRQH (PDLO VDOHV#]DEDWWFRP :HEVLWH KWWS ZZZ]DEDWWFRP 3DJH Page 300 of 414